bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-22_CDS_annotation_glimmer3.pl_2_9 Length=263 Score E Sequences producing significant alignments: (Bits) Value fri:FraEuI1c_4864 transaldolase 35.8 8.6 > fri:FraEuI1c_4864 transaldolase Length=367 Score = 35.8 bits (81), Expect = 8.6, Method: Compositional matrix adjust. Identities = 24/78 (31%), Positives = 34/78 (44%), Gaps = 8/78 (10%) Query 36 WLETV----YTGGNYMERCETPMFEGGVSQEIVFQEVISNSASQEEPLGTLAGRGVTTGR 91 WL+ + GN E T G + +FQ+ I++S + EE L LA RGV G Sbjct 16 WLDDISRDRLNSGNLAELARTHSVVGVTTNPTIFQKAITSSKAYEEQLHDLAIRGVDVGE 75 Query 92 QKGGHIRIKVTEPCYIMC 109 IR+ T + C Sbjct 76 A----IRLITTADVRVAC 89 Lambda K H a alpha 0.318 0.135 0.419 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 399549598308