bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-26_CDS_annotation_glimmer3.pl_2_1 Length=101 Score E Sequences producing significant alignments: (Bits) Value glj:GKIL_1910 hypothetical protein 34.3 0.62 pol:Bpro_2918 adenylate cyclase 34.7 1.8 mze:101481826 titin-like 34.7 2.6 > glj:GKIL_1910 hypothetical protein Length=85 Score = 34.3 bits (77), Expect = 0.62, Method: Compositional matrix adjust. Identities = 15/63 (24%), Positives = 36/63 (57%), Gaps = 1/63 (2%) Query 26 EIEEREVSKNGIFVLIRNKNNKWVITMCGSLVNAKEFDTKEEAEEHIAKKEWEDILTAAF 85 EI++++ ++GIF+ R + W++ +CG + + T A+ +++ + + TA+F Sbjct 3 EIDDKDKLESGIFI-YRLQKGIWLLGICGWIFGLCDRTTAALADGYLSALDMVLLFTASF 61 Query 86 IFI 88 F+ Sbjct 62 FFV 64 > pol:Bpro_2918 adenylate cyclase Length=508 Score = 34.7 bits (78), Expect = 1.8, Method: Composition-based stats. Identities = 20/84 (24%), Positives = 41/84 (49%), Gaps = 2/84 (2%) Query 9 LLAESGKKEEEIKNVNLEIEEREVSKNGIFVLIRNKNNKWVITMCGSLVNAKEFDTKEEA 68 LLA +++ N+ + +R +++ GI + +R +W+ T+ G + +EE Sbjct 34 LLAPVRATHKQLDNIYFDTPQRRLARAGIALRLRRDGRRWLQTVKGGSNSQAGLHQREEI 93 Query 69 EEHIAKK--EWEDILTAAFIFILR 90 E +A EW+ + AF +L+ Sbjct 94 EFSVAGPALEWKPLAGTAFEPVLK 117 > mze:101481826 titin-like Length=31911 Score = 34.7 bits (78), Expect = 2.6, Method: Composition-based stats. Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 3/72 (4%) Query 8 QLLAESGKKE--EEIKNVNLEIEEREVSKNGIFVLIRNKNNKWVITMCG-SLVNAKEFDT 64 ++L++ GK E E+ + +LEI E E S +G++ + V TMC S+ +K T Sbjct 31440 KVLSQGGKYELFEDSGSAHLEIYELEASDSGVYKCTATNSAGAVSTMCTVSVQGSKSSKT 31499 Query 65 KEEAEEHIAKKE 76 K E E + K+E Sbjct 31500 KAEISEEVVKRE 31511 Lambda K H a alpha 0.311 0.129 0.348 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 127879331103