bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-37_CDS_annotation_glimmer3.pl_2_2 Length=147 Score E Sequences producing significant alignments: (Bits) Value ehx:EMIHUDRAFT_222312 hypothetical protein 34.3 9.8 > ehx:EMIHUDRAFT_222312 hypothetical protein Length=624 Score = 34.3 bits (77), Expect = 9.8, Method: Composition-based stats. Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 2/67 (3%) Query 81 ENLSIYYFYPLTDVDIMKSSYSEIVFYSPVLRASYADYAADNRERIKHKALNDKNSLLIA 140 ++LS +++P + + +VF S LR + DYAA N +K L+DK+ L+I Sbjct 272 QSLSDSFYFPFFSLVFFSPARMVVVFKSARLREAVLDYAAAN--SVKLFKLSDKSLLVIT 329 Query 141 AVDKKPV 147 + K V Sbjct 330 GISKALV 336 Lambda K H a alpha 0.321 0.134 0.395 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 127486103328