bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-3_CDS_annotation_glimmer3.pl_2_2 Length=56 Score E Sequences producing significant alignments: (Bits) Value ath:AT5G43400 hypothetical protein 33.1 2.8 aly:ARALYDRAFT_917317 hypothetical protein 32.7 4.6 > ath:AT5G43400 hypothetical protein Length=655 Score = 33.1 bits (74), Expect = 2.8, Method: Composition-based stats. Identities = 21/53 (40%), Positives = 28/53 (53%), Gaps = 4/53 (8%) Query 5 TDIQSV--RVLHYAVSTDYVEDFTQMIKDTFVHPDISFTDIIYSSDSRQFFQL 55 TD Q V R+L AV + +D QMIK FV D+ F D + +S S + L Sbjct 503 TDFQIVFDRILEVAVENNLTDD--QMIKRLFVFSDMEFDDAMANSHSEVSYHL 553 > aly:ARALYDRAFT_917317 hypothetical protein Length=657 Score = 32.7 bits (73), Expect = 4.6, Method: Composition-based stats. Identities = 20/53 (38%), Positives = 29/53 (55%), Gaps = 4/53 (8%) Query 5 TDIQSV--RVLHYAVSTDYVEDFTQMIKDTFVHPDISFTDIIYSSDSRQFFQL 55 TD Q V R+L AV + ++ QMIK FV D+ F D + +S S ++L Sbjct 505 TDFQKVFDRILEVAVENNLTDE--QMIKRLFVFSDMEFDDAMANSHSEVSYRL 555 Lambda K H a alpha 0.329 0.140 0.399 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 127142967006