BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eace_1916_orf1 (113 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|149190408|ref|ZP_01868680.1| transcriptional regulator, LysR ... 34 5.8 >gi|149190408|ref|ZP_01868680.1| transcriptional regulator, LysR family protein [Vibrio shilonii AK1] gi|148835787|gb|EDL52752.1| transcriptional regulator, LysR family protein [Vibrio shilonii AK1] Length = 293 Score = 34.3 bits (77), Expect = 5.8, Method: Compositional matrix adjust. Identities = 26/96 (27%), Positives = 46/96 (47%) Query: 10 GKEMSFATRTASSQSDAGNSIEPLHRRSLSNRSCLHTTSTRVVWGRADRLRSAPDGRAGA 69 G E+ TR +DAG+++ P R L+ L++ + + G +D++R A D + Sbjct: 44 GVELFERTRNRLVLNDAGSALLPDCRNILNMAESLYSKAEQFRQGDSDKIRIAYDDTLPS 103 Query: 70 SFRTALVPARSFSLPLLGPPVLKATPSGAPSASFRN 105 SF + A S P + V+KA+ + P+ N Sbjct: 104 SFWRKQLVALSDEFPHVSLTVIKASSADIPTLVREN 139 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.313 0.124 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,113,727,012 Number of extensions: 41328932 Number of successful extensions: 84701 Number of sequences better than 10.0: 26 Number of HSP's gapped: 86217 Number of HSP's successfully gapped: 26 Length of query: 113 Length of database: 5,058,227,080 Length adjustment: 81 Effective length of query: 32 Effective length of database: 3,861,230,788 Effective search space: 123559385216 Effective search space used: 123559385216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 76 (33.9 bits)