BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eace_2490_orf1 (105 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|221484462|gb|EEE22758.1| UBX domain-containing protein, putat... 59 2e-07 gi|221505569|gb|EEE31214.1| UBX domain-containing protein, putat... 59 2e-07 gi|237837953|ref|XP_002368274.1| UBX domain-containing protein [... 59 2e-07 gi|156083625|ref|XP_001609296.1| hypothetical protein [Babesia b... 43 0.015 >gi|221484462|gb|EEE22758.1| UBX domain-containing protein, putative [Toxoplasma gondii GT1] Length = 492 Score = 58.9 bits (141), Expect = 2e-07, Method: Composition-based stats. Identities = 32/77 (41%), Positives = 40/77 (51%), Gaps = 1/77 (1%) Query: 2 ICLKLACGKRITRIFXXXXXXXXXYRWCGCVAEYCELPSLRIPAKFDLVVSPYRVLPK-E 60 ICL+L G R +R F Y W C+AE+ E + IP F LVV P R LP+ Sbjct: 409 ICLRLPSGSRFSRQFPAQTSLEELYLWADCLAEFTENEEIDIPLNFHLVVPPRRTLPRGA 468 Query: 61 GTLEAAGLCPNCVVLLM 77 TL + L PN VLL+ Sbjct: 469 ATLLDSDLHPNSAVLLV 485 >gi|221505569|gb|EEE31214.1| UBX domain-containing protein, putative [Toxoplasma gondii VEG] Length = 491 Score = 58.9 bits (141), Expect = 2e-07, Method: Composition-based stats. Identities = 32/77 (41%), Positives = 40/77 (51%), Gaps = 1/77 (1%) Query: 2 ICLKLACGKRITRIFXXXXXXXXXYRWCGCVAEYCELPSLRIPAKFDLVVSPYRVLPK-E 60 ICL+L G R +R F Y W C+AE+ E + IP F LVV P R LP+ Sbjct: 408 ICLRLPSGSRFSRQFPAQTSLEELYLWADCLAEFTENEEIDIPLNFHLVVPPRRTLPRGA 467 Query: 61 GTLEAAGLCPNCVVLLM 77 TL + L PN VLL+ Sbjct: 468 ATLLDSDLHPNSAVLLV 484 >gi|237837953|ref|XP_002368274.1| UBX domain-containing protein [Toxoplasma gondii ME49] gi|211965938|gb|EEB01134.1| UBX domain-containing protein [Toxoplasma gondii ME49] Length = 492 Score = 58.9 bits (141), Expect = 2e-07, Method: Composition-based stats. Identities = 32/77 (41%), Positives = 40/77 (51%), Gaps = 1/77 (1%) Query: 2 ICLKLACGKRITRIFXXXXXXXXXYRWCGCVAEYCELPSLRIPAKFDLVVSPYRVLPK-E 60 ICL+L G R +R F Y W C+AE+ E + IP F LVV P R LP+ Sbjct: 409 ICLRLPSGSRFSRQFPAQTSLEELYLWADCLAEFTENEEIDIPLNFHLVVPPRRTLPRGA 468 Query: 61 GTLEAAGLCPNCVVLLM 77 TL + L PN VLL+ Sbjct: 469 ATLLDSDLHPNSAVLLV 485 >gi|156083625|ref|XP_001609296.1| hypothetical protein [Babesia bovis T2Bo] gi|154796547|gb|EDO05728.1| conserved hypothetical protein [Babesia bovis] Length = 354 Score = 43.1 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 27/78 (34%), Positives = 39/78 (50%), Gaps = 3/78 (3%) Query: 2 ICLKLACGKRITRIFXXXXXXXXXYRWCGCVAEYCELPSLRIPAKFDL-VVSPYRVLP-K 59 I ++L G I IF Y W G AEY ++IP FD+ + P + L + Sbjct: 268 IKVRLPSGSSIESIFRKDDTVGRLYEWVG-AAEYFSAGKVKIPYDFDICTMFPSKTLSDR 326 Query: 60 EGTLEAAGLCPNCVVLLM 77 TLE+A LCPN ++L+ Sbjct: 327 TQTLESANLCPNASLVLI 344 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.329 0.144 0.483 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 652,476,469 Number of extensions: 18173812 Number of successful extensions: 34920 Number of sequences better than 10.0: 4 Number of HSP's gapped: 34994 Number of HSP's successfully gapped: 4 Length of query: 105 Length of database: 5,058,227,080 Length adjustment: 73 Effective length of query: 32 Effective length of database: 3,979,452,644 Effective search space: 127342484608 Effective search space used: 127342484608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 76 (33.9 bits)