BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_2161_orf1 (147 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|325114541|emb|CBZ50097.1| gk24670, related [Neospora caninum ... 41 0.048 gi|221482502|gb|EEE20850.1| conserved hypothetical protein [Toxo... 40 0.16 gi|221504541|gb|EEE30214.1| conserved hypothetical protein [Toxo... 39 0.18 gi|237841511|ref|XP_002370053.1| hypothetical protein TGME49_022... 39 0.18 gi|302408971|ref|XP_003002320.1| BIP4 [Verticillium albo-atrum V... 34 8.6 >gi|325114541|emb|CBZ50097.1| gk24670, related [Neospora caninum Liverpool] Length = 620 Score = 41.2 bits (95), Expect = 0.048, Method: Compositional matrix adjust. Identities = 20/47 (42%), Positives = 26/47 (55%) Query: 1 TLGPWDSMSARGGASWSSTYSKQYGKDRWSNLLQALSEAPNQLAFVA 47 T G + RG + WS+ + QYG RW+ LLQAL+ AFVA Sbjct: 11 TAGASSGVVLRGASGWSAFHEHQYGSARWNRLLQALAGEGRFAAFVA 57 >gi|221482502|gb|EEE20850.1| conserved hypothetical protein [Toxoplasma gondii GT1] Length = 552 Score = 39.7 bits (91), Expect = 0.16, Method: Compositional matrix adjust. Identities = 17/37 (45%), Positives = 24/37 (64%) Query: 11 RGGASWSSTYSKQYGKDRWSNLLQALSEAPNQLAFVA 47 RG + WS+ + +QYG RW +LL+AL+ AFVA Sbjct: 19 RGASGWSAYHERQYGSARWKSLLRALAGEGRFAAFVA 55 >gi|221504541|gb|EEE30214.1| conserved hypothetical protein [Toxoplasma gondii VEG] Length = 552 Score = 39.3 bits (90), Expect = 0.18, Method: Compositional matrix adjust. Identities = 17/37 (45%), Positives = 24/37 (64%) Query: 11 RGGASWSSTYSKQYGKDRWSNLLQALSEAPNQLAFVA 47 RG + WS+ + +QYG RW +LL+AL+ AFVA Sbjct: 19 RGASGWSAYHERQYGSARWKSLLRALAGEGRFAAFVA 55 >gi|237841511|ref|XP_002370053.1| hypothetical protein TGME49_022340 [Toxoplasma gondii ME49] gi|211967717|gb|EEB02913.1| hypothetical protein TGME49_022340 [Toxoplasma gondii ME49] Length = 552 Score = 39.3 bits (90), Expect = 0.18, Method: Compositional matrix adjust. Identities = 17/37 (45%), Positives = 24/37 (64%) Query: 11 RGGASWSSTYSKQYGKDRWSNLLQALSEAPNQLAFVA 47 RG + WS+ + +QYG RW +LL+AL+ AFVA Sbjct: 19 RGASGWSAYHERQYGSARWKSLLRALAGEGRFAAFVA 55 >gi|302408971|ref|XP_003002320.1| BIP4 [Verticillium albo-atrum VaMs.102] gi|261359241|gb|EEY21669.1| BIP4 [Verticillium albo-atrum VaMs.102] Length = 846 Score = 33.9 bits (76), Expect = 8.6, Method: Compositional matrix adjust. Identities = 37/160 (23%), Positives = 65/160 (40%), Gaps = 24/160 (15%) Query: 2 LGPWDSMSARGGASWSSTYSKQY-----GKDRWSNLLQALSEAP--------NQLAFVAP 48 GP S G+SW ST+ +Q+ + W+ A++E P Q+A Sbjct: 593 FGPVSKNSQARGSSWRSTFGRQHCMSILTRASWA----AITELPLTINRRNHGQIAQFVK 648 Query: 49 NISHSALRYL---LRKQRLVPCIIP--NCLTCSDNAPLKEXXXXXXXXXXXXCGSGTTAA 103 N+ ++ + + + LVP I N L C +P +E G +A Sbjct: 649 NVVYNKEMVIPLSVEQHALVPQFILFFNSLFCHMVSPCEEGDLPTANSWVIDLQEGVESA 708 Query: 104 --PTDCNVSDGPFSVPSQPKAEASSCPALHGNNTESVAVV 141 + N++ F++ + A + P+LHGN S+ +V Sbjct: 709 IGTSFSNLASSNFTLELVRRIFAQNLPSLHGNGRASILIV 748 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.313 0.128 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,437,060,939 Number of extensions: 49067696 Number of successful extensions: 85016 Number of sequences better than 10.0: 5 Number of HSP's gapped: 85524 Number of HSP's successfully gapped: 5 Length of query: 147 Length of database: 5,058,227,080 Length adjustment: 110 Effective length of query: 37 Effective length of database: 3,432,676,560 Effective search space: 127009032720 Effective search space used: 127009032720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 76 (33.9 bits)