BLASTP 2.2.24 [Aug-08-2010] 

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Eten_4640_orf1
         (139 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           14,777,732 sequences; 5,058,227,080 total letters

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|308811596|ref|XP_003083106.1| unnamed protein product [Ostreo...    41     0.048

>gi|308811596|ref|XP_003083106.1| unnamed protein product [Ostreococcus tauri]
 gi|116054984|emb|CAL57061.1| unnamed protein product [Ostreococcus tauri]
          Length = 272

 Score = 41.2 bits (95), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 34/59 (57%)

Query: 35  VGAQASGEAHFLQPFEVFPPKGVQVVRGNGGGLSVLHVLLPGQEPGRDAELRRTPHDRH 93
           V +Q S  ++ LQ  EV     V++V  +   L++L ++L  QEP R++EL R  HD H
Sbjct: 53  VVSQTSVVSNLLQTLEVVAQLRVELVGHHLRELAILEIVLAVQEPIRNSELSRVGHDHH 111


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF excluding environmental samples
  from WGS projects
    Posted date:  Jul 22, 2011  4:42 PM
  Number of letters in database: 5,058,227,080
  Number of sequences in database:  14,777,732
  
Lambda     K      H
   0.315    0.136    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 14777732
Number of Hits to DB: 992,539,775
Number of extensions: 34965050
Number of successful extensions: 52996
Number of sequences better than 10.0: 1
Number of HSP's gapped: 53158
Number of HSP's successfully gapped: 1
Length of query: 139
Length of database: 5,058,227,080
Length adjustment: 103
Effective length of query: 36
Effective length of database: 3,536,120,684
Effective search space: 127300344624
Effective search space used: 127300344624
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 76 (33.9 bits)