BLASTP 2.2.24 [Aug-08-2010] 

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Eten_8134_orf6
         (67 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           14,777,732 sequences; 5,058,227,080 total letters

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|21243163|ref|NP_642745.1| Tn5044 transposase [Xanthomonas axo...    34     5.6  

>gi|21243163|ref|NP_642745.1| Tn5044 transposase [Xanthomonas axonopodis pv. citri str. 306]
 gi|21108686|gb|AAM37281.1| Tn5044 transposase [Xanthomonas axonopodis pv. citri str. 306]
          Length = 416

 Score = 34.3 bits (77), Expect = 5.6,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 4/63 (6%)

Query: 4   EKSKTRSSSQIPNFVRHHQLPHYFSQFGGKQDLGGHTTASVPPRNPFCSSLYVVCISFRY 63
           E+S  RS ++I ++   HQL    +Q GGK++L GHT   +   N  C+ L    I +  
Sbjct: 300 ERSVHRSQNRIESY---HQLRSTIAQVGGKKELTGHTDIEIEISNQ-CARLMANAIIYYN 355

Query: 64  SSV 66
           S++
Sbjct: 356 SAI 358


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF excluding environmental samples
  from WGS projects
    Posted date:  Jul 22, 2011  4:42 PM
  Number of letters in database: 5,058,227,080
  Number of sequences in database:  14,777,732
  
Lambda     K      H
   0.319    0.132    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 14777732
Number of Hits to DB: 678,391,902
Number of extensions: 21364670
Number of successful extensions: 37470
Number of sequences better than 10.0: 1
Number of HSP's gapped: 37609
Number of HSP's successfully gapped: 1
Length of query: 67
Length of database: 5,058,227,080
Length adjustment: 39
Effective length of query: 28
Effective length of database: 4,481,895,532
Effective search space: 125493074896
Effective search space used: 125493074896
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 76 (33.9 bits)