bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0005_orf2 Length=230 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd7_4910 231 2e-59 > 5807.cgd7_4910 Length=311 Score = 231 bits (588), Expect = 2e-59, Method: Compositional matrix adjust. Identities = 105/227 (46%), Positives = 153/227 (67%), Gaps = 4/227 (1%) Query 7 VSGFTLNDAILLFAFLYSSSDVFVEWDAFAACAKPVHYWLLGSYGALIAFRLSHYLGQYL 66 ++GF +NDAIL AF+YSS+D+ +WD+F+ C P+ WL+ SY +IAFR+ HY+ YL Sbjct 1 MTGFGINDAILGLAFMYSSADLISQWDSFSTCCHPIQLWLIISYITIIAFRVIHYVSNYL 60 Query 67 SEDGEDFMLYRQ-RGPPFWVNVLILGILFPCFFGWTVVGTFWFLEVQEETPFCLPRE--S 123 SE +D + Y G PFW+N+ ++ ++FP F WTVVGT W ++ +TP CL S Sbjct 61 SEGSDDVLPYSSTSGIPFWLNLSVVCLIFPFFLSWTVVGTVWLKNIESKTPQCLAGNGSS 120 Query 124 HPWFFTFWLALCYVWILIYIVFIVMAAVFEYRARRMEADLRLLQNEDMIRRWGRVRVFSE 183 HPWF FWL LCY+WI+ Y FI ++ FE+R RR E DL LL+N++++RRWGR+R+ ++ Sbjct 121 HPWFLIFWLVLCYIWIVAYTAFISISIFFEFRVRRAEEDLLLLENDEVMRRWGRLRLLAD 180 Query 184 YGIYIFRRGLTTDQIRRLPCQKLNYDPVEMMPCSICLEEFAQDEYVR 230 YGI+ R GLT ++ LP K+ + PCSIC+E+F +E +R Sbjct 181 YGIHFIRHGLTPVEVAALPLSKVKVEEFN-DPCSICIEDFKLNEEIR 226 Lambda K H 0.333 0.146 0.499 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 64397904082 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40