bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0041_orf1 Length=483 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0495 62.0 5e-08 > 5833.PF14_0495 Length=2189 Score = 62.0 bits (149), Expect = 5e-08, Method: Composition-based stats. Identities = 57/256 (22%), Positives = 108/256 (42%), Gaps = 45/256 (17%) Query 250 LLESLDPSILSSLLTSFDWIVHTQATLQVNQSASMY--HDLEAPSQQYKTTGEKKEGYRL 307 LL+ + +L ++ +S + HT AT+Q+ Q+A H+ QY + G Sbjct 1548 LLQHIPAHMLENITSSIRFTTHTIATMQIIQNAKYMSKHNF----SQYDSKGMLARQI-F 1602 Query 308 SSGGLVKTTDKQLEDWAEYG-------------IPASLSRKLRRGEKLPKSVAFEKIATP 354 + GG + D + W G + S+ +L+ E+ ++ + E+ A Sbjct 1603 TKGGFAEYADNLMAKWFSKGFEEYKREQIENFKMENSIDSELKDSEREDENDSSEESAKK 1662 Query 355 DLT----------------------KWEQQLNNKWLDALSAYLEHPYGRAALAARDPVAL 392 L KW+Q +N + + AL +LE + A V Sbjct 1663 KLQDLQLEEREKMKKENSLLFNQSDKWDQFINKELVRALGLWLE--FNDNPTNASSFVYK 1720 Query 393 LVKESKDRLEAEVDSTIFLGRVVKVPRMSKFKKAMKAISNFFRAILRAPE-QSEYAVWMG 451 +V++SK LE +D+ I R VK + + F++ I + +LR P + E+A+W G Sbjct 1721 VVEDSKHLLENNIDNNIIFSRTVKPTKQTAFRRFFNKILSLGNMLLRKPSFRVEHALWFG 1780 Query 452 VKVNVDKVLAVMKAVN 467 +++ K +++ V+ Sbjct 1781 ATIDIKKAFILLEKVS 1796 Lambda K H 0.319 0.130 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 206269077339 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40