bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0046_orf1 Length=114 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL8P1.146 82.4 4e-15 > 5833.MAL8P1.146 Length=728 Score = 82.4 bits (202), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 45/105 (42%), Positives = 71/105 (67%), Gaps = 7/105 (6%) Query 13 ERESLACKKLGELQLLVDSKFEAEIAVR----QEQLNLIKREVERLVKGDEAHEQFRAFI 68 E+E+ CKKL E++ ++K + E +R QE ++ I+ E++R KG +E F+ F+ Sbjct 626 EKENNICKKLEEIEKKNEAKIDTEKNIRDSKYQEIISYIE-EIKREKKG--KNENFQNFV 682 Query 69 MEELMALKNGLALATQAREQSDDEIIQAINQYTTALQKGLRTINA 113 +EE+ +KNGL + +QARE +DD+I+QA+N YT ALQ LR IN+ Sbjct 683 LEEIATIKNGLIMESQAREAADDDIVQAVNHYTKALQDSLRLINS 727 Lambda K H 0.315 0.129 0.329 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22778399648 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40