bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0175_orf1 Length=169 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd5_1040 118 8e-26 > 5807.cgd5_1040 Length=215 Score = 118 bits (295), Expect = 8e-26, Method: Compositional matrix adjust. Identities = 49/93 (52%), Positives = 71/93 (76%), Gaps = 2/93 (2%) Query 79 VDDRRYVSESDRDEIFR--RLRKDNRMCFDCSARNPTWISLTHAVYVCLSCSGKHRRLGT 136 VD++ +VS+ RD F+ R R +NR CFDC +RNPTW+SL+ AV++CL+CS HR++G Sbjct 11 VDEKGFVSDKLRDNFFQIVRNRPENRTCFDCESRNPTWLSLSFAVFICLNCSSDHRKMGV 70 Query 137 HLSFVRSTEMDKIYPEQLFRMELGGNRRAQEFL 169 H+SFVRS+++DK P QL RM++GGN RA+ + Sbjct 71 HISFVRSSDLDKFTPIQLVRMDIGGNGRARNYF 103 Lambda K H 0.320 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 30997188850 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40