bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0182_orf1 Length=117 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0108 103 1e-21 > 5833.PF11_0108 Length=1329 Score = 103 bits (258), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 48/102 (47%), Positives = 63/102 (61%), Gaps = 0/102 (0%) Query 1 RLFWKDQKIAKARKWMNRSVTLDPSLGDAWASFLAFEIEHGGEKECIDVINRCALAQPNR 60 +LFW + KI KARKW R + L+P GD WA+FLAFEI+ E D+IN+C A+PNR Sbjct 1134 KLFWVNFKIQKARKWFYRVINLNPHFGDGWATFLAFEIDQQNEINQKDIINKCIKAEPNR 1193 Query 61 GLAWNKTTKQVRCWSFSPAQKLNAVLEYMYPNALKDGISQVV 102 G WNK TK+V W QKL ++ +YP+ L IS + Sbjct 1194 GYLWNKITKRVENWRLKYPQKLYKYIKDIYPHVLNKKISDPI 1235 Lambda K H 0.319 0.132 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22540005152 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40