bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0188_orf1 Length=169 Score E Sequences producing significant alignments: (Bits) Value 9606.ENSP00000262848 188 6e-47 > 9606.ENSP00000262848 Length=358 Score = 188 bits (477), Expect = 6e-47, Method: Compositional matrix adjust. Identities = 88/151 (58%), Positives = 112/151 (74%), Gaps = 1/151 (0%) Query 10 CVGRTWTLCGTHEYLAPESITRRGHGLQVDWWALGILLFEMLAGRPPFVDDTPLGIYKKI 69 V RTWTLCGT EYLAPE I +GHG VDWWALGIL+FEML+G PPF DD P GIY+KI Sbjct 197 LVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKI 256 Query 70 IAGKIEFPALFDCSAKSLIKRLLIHEPNKRYGCLKDGAEDVKNHKFFRGIDWELCYQRKI 129 +AGKI+FP D K LIK+LL+ + +R G +K+GA DVK+H++FR +DWE QRK+ Sbjct 257 LAGKIDFPRHLDFHVKDLIKKLLVVDRTRRLGNMKNGANDVKHHRWFRSVDWEAVPQRKL 316 Query 130 RPPYKPNIQGPRDSSMFDTYAEST-ESSAPV 159 +PP P I G D+S F+TY E+ +++APV Sbjct 317 KPPIVPKIAGDGDTSNFETYPENDWDTAAPV 347 Lambda K H 0.323 0.142 0.458 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 30997188850 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40