bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0285_orf1 Length=170 Score E Sequences producing significant alignments: (Bits) Value 5833.PFI0755c 145 7e-34 > 5833.PFI0755c Length=1418 Score = 145 bits (365), Expect = 7e-34, Method: Composition-based stats. Identities = 64/131 (48%), Positives = 90/131 (68%), Gaps = 0/131 (0%) Query 40 KSFGFLSALQRERLTHRPPVPPLCLDPKCKARPMKQVLCKDPYTQRQVLMHYPYLANSTL 99 KS G +S LQ RL ++ +P LC D K K R KQ + DPYTQ+Q+L +YP+++ Sbjct 773 KSLGCMSELQTSRLYNKLELPELCSDLKAKVRAGKQYISNDPYTQKQILSNYPHMSYENK 832 Query 100 FYLHEVAHDKYTPPINYGLRVGFVLLSRQSPGVMNVLWGLHERLKMVQGKCLAFFGLTGL 159 F + E+ HDKY PI++ +R+G V LSRQ+PG MNVL GL+ RLK+++G C+AF+GL GL Sbjct 833 FQIQEIFHDKYASPISFEIRIGIVFLSRQAPGAMNVLCGLYRRLKLLKGVCIAFYGLYGL 892 Query 160 IEKNYIEITDE 170 + YI I D+ Sbjct 893 LHNKYIIIDDD 903 Lambda K H 0.323 0.140 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 31617132627 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40