bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0423_orf3 Length=187 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL8P1.13 124 1e-27 > 5833.MAL8P1.13 Length=505 Score = 124 bits (312), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 59/148 (39%), Positives = 96/148 (64%), Gaps = 7/148 (4%) Query 46 EDVSISAQHQKPT-KQCSSGEWDSSVPEEGRALLDEKGLI------PVPFATRVVSSLIA 98 ED S + +K + CS+ S + + L EK + P ++ SSLIA Sbjct 2 EDDDFSIKDKKENYETCSTETISSYISINEKCQLIEKDINDDNHENPYMIFNKISSSLIA 61 Query 99 MLQGVEVLCNLAILYLFKDDFRIDPALLAVVLGALRLPWTVKPLWALAADNFPLFGYRRK 158 MLQGVEVLCNL+I+YL KD++ + PA L++V+ +++PW++K +WA+ +DN+P+FGYRRK Sbjct 62 MLQGVEVLCNLSIIYLLKDNYHLHPASLSIVMCFIKIPWSIKLVWAVISDNYPIFGYRRK 121 Query 159 SYIFLGASMCIVATLGIGLGGYKSLYAT 186 Y+ LG+ +CI++ + +GL + +L+ T Sbjct 122 YYLLLGSFLCILSLICLGLITHNNLFIT 149 Lambda K H 0.324 0.139 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 40588496850 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40