bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0862_orf1 Length=141 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0311 85.5 4e-16 > 5833.PF14_0311 Length=269 Score = 85.5 bits (210), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 41/108 (37%), Positives = 74/108 (68%), Gaps = 3/108 (2%) Query 37 DDSRKRKQ---IDEQRYQEIKDSIVAVEKTLNQEIKRRVDANKTLQQISEQMANEMLDRL 93 D+ R +K+ ++ Y+E+K I+ +E+ +N E+K+R+DANK +Q + EQMAN M++ + Sbjct 39 DEGRNKKKNSCSNDNFYEEMKYDILRIERNINSEVKKRLDANKNIQLLIEQMANNMINNV 98 Query 94 QLRIVKYIESLTVSMDMLITRCESLEKGLAQMKGDLPSKLAQDFAALQ 141 +I IES++ +D +I +CE LEK ++Q+K D+P+K+ D +L+ Sbjct 99 LNKITTKIESISSDLDKIIHKCEELEKVISQIKVDIPTKIQTDMISLK 146 Lambda K H 0.316 0.129 0.330 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22827922775 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40