bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0876_orf2 Length=164 Score E Sequences producing significant alignments: (Bits) Value 5833.PFE0425w 124 1e-27 > 5833.PFE0425w Length=262 Score = 124 bits (310), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 67/136 (49%), Positives = 84/136 (61%), Gaps = 9/136 (6%) Query 30 MPATAGWVRMPQSNRVAVSASLRTHAIWTESVGYDPYAP--EKQQEAAAAEDALKDKAKE 87 MP+ +G VRMP NR+ VSASL+T IW SVGYDPYA E ++ ++ + +KAK Sbjct 1 MPSKSGRVRMPADNRLPVSASLKTSEIWKNSVGYDPYASYEEINKKKEKKDEDINEKAKN 60 Query 88 LLTLARLTGTLSTHTPGACTKCNQVGHLSFQCRNDIRLVDPQKTETLNRTLKMKEEEEDD 147 L L+RLTG ST PGACT CN +GHL +QCRN I L E + M EEDD Sbjct 61 LFNLSRLTGITSTTIPGACTVCNHIGHLPYQCRNFISL------EKFDINNNMNNNEEDD 114 Query 148 ERLRRALGI-GSDDEG 162 + R+ LG+ SDDEG Sbjct 115 IKERKNLGLMSSDDEG 130 Lambda K H 0.310 0.124 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 28631644438 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40