bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0946_orf1 Length=226 Score E Sequences producing significant alignments: (Bits) Value 3702.AT1G74230.1 62.0 1e-08 > 3702.AT1G74230.1 Length=289 Score = 62.0 bits (149), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 40/115 (34%), Positives = 60/115 (52%), Gaps = 8/115 (6%) Query 33 YLQRRGRELNRELSLLAEQVNEAQGITTKSLTKVFVGGLAYSTSRYDLCELFAEVGNIKS 92 +L + GR ++ S + + Q I S +K+FVGG++YST + L E F++ G + Sbjct 3 FLSKVGRLFSQTSSHVTASSSMLQSIRCMSSSKIFVGGISYSTDEFGLREAFSKYGEV-- 60 Query 93 IVIPQVDRSIPPDYEGAYSVRGIAFVQFEDAESAKKALQCNGKIVNGRSVVVTPA 147 VD I D E S RG AFV F E A A+Q +G+ ++GR + V A Sbjct 61 -----VDAKIIVDRETGRS-RGFAFVTFTSTEEASNAMQLDGQDLHGRRIRVNYA 109 Lambda K H 0.314 0.130 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 61967794494 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40