bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1475_orf1 Length=178 Score E Sequences producing significant alignments: (Bits) Value 184922.12046 70.9 2e-11 > 184922.12046 Length=244 Score = 70.9 bits (172), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 37/89 (41%), Positives = 55/89 (61%), Gaps = 9/89 (10%) Query 28 LADLHNYSTANSFQQKRYNWETLSERVFKRVGLKLTAAEIDGVVAAKPGAAESIIRRFKQ 87 L +LHNY + + + KR NWETL ++V KR+ LKL+A EID +++AKPGA E ++ R + Sbjct 51 LVELHNYQSTTNSEAKRKNWETLQQKVLKRLQLKLSADEIDALISAKPGAIERVLIRVRS 110 Query 88 RAEALKQQSARDAEGTTKGTHLARCAPQA 116 A+ + SAR E H +R P+ Sbjct 111 ---AIMRVSARSEE------HPSRSDPRG 130 Lambda K H 0.312 0.122 0.333 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 35812709058 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40