bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1496_orf2 Length=129 Score E Sequences producing significant alignments: (Bits) Value 5518.FG05406.1 158 5e-38 > 5518.FG05406.1 Length=456 Score = 158 bits (399), Expect = 5e-38, Method: Compositional matrix adjust. Identities = 74/129 (57%), Positives = 94/129 (72%), Gaps = 2/129 (1%) Query 1 AYLHANFVFHRDVKPSNLLYSNKGVLKLADFGMARKFGVPPGHQKYTKEVVTLWYRPPEI 60 AYLH N++ HRD+K SNLL +N+G LK+ADFGMAR G PP K T+ VVTLWYR PE+ Sbjct 215 AYLHDNWILHRDLKTSNLLLNNRGQLKIADFGMARYVGDPP--PKLTQLVVTLWYRAPEL 272 Query 61 LLGQALYNAKCDVWAVGCIFGELLLRRPLFAGQGEFDTLTKIWKLCGTQSEETWRGFNEL 120 LLG Y+A D+W+VGCIFGELL R PL G+ E D +++I++LCG +EETW GF L Sbjct 273 LLGAKTYDAAVDMWSVGCIFGELLTREPLLQGKNEVDQVSRIFELCGVPTEETWPGFRRL 332 Query 121 PLIKNKSLP 129 P ++ LP Sbjct 333 PNARSLRLP 341 Lambda K H 0.323 0.142 0.464 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22342951125 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40