bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1931_orf1 Length=161 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL13P1.310 119 4e-26 > 5833.MAL13P1.310 Length=2030 Score = 119 bits (297), Expect = 4e-26, Method: Composition-based stats. Identities = 53/85 (62%), Positives = 68/85 (80%), Gaps = 0/85 (0%) Query 61 PVYNPRGMYGVKLFFNGVARKVLVDDYLPTKVDGKLLCAHSQQAAELWVSLLEKAFVKLM 120 P++NP GMY +L NG+ RK+++DDY+P K + LL A+S ELWV+LLEKAFVKLM Sbjct 1075 PIFNPCGMYICRLHCNGIQRKIIIDDYVPVKNNNSLLVAYSNNQKELWVTLLEKAFVKLM 1134 Query 121 GGSYNMQGSNPGADLYHLTGWLPET 145 GGSY+M GSNPG+DLY+LTGW+P T Sbjct 1135 GGSYSMFGSNPGSDLYYLTGWIPVT 1159 Lambda K H 0.309 0.121 0.352 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 26764363279 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40