bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2190_orf1 Length=189 Score E Sequences producing significant alignments: (Bits) Value 28985.KLLA0C12925g 102 5e-21 > 28985.KLLA0C12925g Length=570 Score = 102 bits (255), Expect = 5e-21, Method: Compositional matrix adjust. Identities = 66/196 (33%), Positives = 104/196 (53%), Gaps = 30/196 (15%) Query 1 GFGFVTFEDIETINNVVDRHHTIDDSQVEVRRAIPREEARTAQPRRERETTENSGRVFIG 60 GFGF+TFE+ +++ VV H +D ++ +RAIPREE + +G++F+G Sbjct 228 GFGFLTFENASSVDEVVKTQHILDGKVIDPKRAIPREEQ------------DKTGKIFVG 275 Query 61 GLGDDVTDEVLKEFFSRFGELTSASVMVDRETNGPRGFGFIIYKNPEDAEKALGIHKDL- 119 G+G DV + +EFFS++G + A +M+D++T RGFGFI Y P DA + +K + Sbjct 276 GIGPDVRPKEFEEFFSQWGSIIDAQLMLDKDTGRSRGFGFITYDTP-DAVDRVCQNKFIE 334 Query 120 --GPNAEAKRAQPR--SQTSRMRMFGVGGYPMSGPYR----YEDPRFAVARSGYGGAGGP 171 G E KRA+PR + + +M G MS P + +++P A G P Sbjct 335 FKGKQIEIKRAEPRQLQKQKQPQMTQPMGQNMSNPMQQYQMFQNPMMA-------GGFNP 387 Query 172 QMYGGYN-YAYHPYYA 186 M G+N + + YY Sbjct 388 MMATGFNPQSMNEYYT 403 Lambda K H 0.318 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 41818451300 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40