bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2212_orf1 Length=176 Score E Sequences producing significant alignments: (Bits) Value 5833.PFI1145w 119 4e-26 > 5833.PFI1145w Length=821 Score = 119 bits (298), Expect = 4e-26, Method: Composition-based stats. Identities = 55/133 (41%), Positives = 84/133 (63%), Gaps = 3/133 (2%) Query 45 YLGVGYDIVRGNPLGDPNLMGDPGLRSPVIRFSYSQDEEGVSSDLRELQPRGAYSRPFVA 104 YLGVGYD + GNP+GDP L DPG R +I+ +Y + +E + + P G++ R ++ Sbjct 241 YLGVGYDFIFGNPIGDPFLKVDPGYRDSIIKLTYPKSDEDYPDNYMNINPNGSFVRNEIS 300 Query 105 CKQSENLSEVSSLADYQKELEADASLVGGDSVGL-NSFSASAAYRDIAKRTVKRNTKTFI 163 C +SE SE+S++++Y KEL DAS+ G S GL SFSAS Y+ ++ K + F+ Sbjct 301 CNRSEKESEISTMSEYTKELSVDASI--GASYGLFGSFSASTGYKSVSNTISKNKFRMFM 358 Query 164 LKTYCLRFEAGLA 176 LK+YC ++ A L+ Sbjct 359 LKSYCFKYVASLS 371 Lambda K H 0.315 0.131 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 35336795289 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40