bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2263_orf1 Length=171 Score E Sequences producing significant alignments: (Bits) Value 5691.Tb10.70.3870 87.8 1e-16 > 5691.Tb10.70.3870 Length=1056 Score = 87.8 bits (216), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 50/140 (35%), Positives = 77/140 (55%), Gaps = 23/140 (16%) Query 46 SPQSKTAFLFCVMGGRLSEGVNFSNALARLLVVVGMPFPSVKDKIFILHKEHY------- 98 S +S A LF V+GG+LSEG+NF++ L R +VVVG+P+ ++ + LH H Sbjct 883 SERSSGALLFAVIGGKLSEGINFNDDLGRAVVVVGLPYANISEVDLQLHLRHVADTRVRT 942 Query 99 ----NAIMTNPKATADEAEEAKPAP-SDWPADAKQLQQQQREQHFVDYGLLQ--CMITVN 151 +A + T D ++ P ++PA +++GLL CM +VN Sbjct 943 LLPSSANIATGSITTDSTDQVTVVPDGEFPASPSSA---------MEWGLLTDLCMRSVN 993 Query 152 QTIGRAIRHSKDYAAILLVD 171 Q+IGR IRH+ DYAA++L+D Sbjct 994 QSIGRCIRHASDYAAVILLD 1013 Lambda K H 0.319 0.131 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 32237076404 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40