bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2299_orf1 Length=117 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL7P1.92 109 3e-23 > 5833.MAL7P1.92 Length=2543 Score = 109 bits (272), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 49/112 (43%), Positives = 71/112 (63%), Gaps = 0/112 (0%) Query 4 DWYFIKCPVSSACQEHGSCIETMADFLCSECKPGYTNTFDHEEICTQCPSTGANITLCIL 63 DW+ ++CP+ AC + C E+M +FLC ECK GYTN F +C +C NI I Sbjct 1678 DWFIVECPIKEACLYNEKCHESMTNFLCGECKKGYTNNFSKLNLCIKCSGHIMNILHMIF 1737 Query 64 YYLCLLLFNIAMAYMNVAAGFNRRSIHSIVIKIASNFVTCMWVLSVVDLEQI 115 + +LLF + MAY+NV G NR+S+HSIVIKIA N+ +CM + V+ + ++ Sbjct 1738 VSIFILLFTVIMAYLNVFTGANRKSVHSIVIKIAVNYFSCMKIFYVMGISEL 1789 Lambda K H 0.328 0.138 0.463 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22540005152 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40