bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2502_orf1 Length=121 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0395 85.1 5e-16 > 5833.PF11_0395 Length=4226 Score = 85.1 bits (209), Expect = 5e-16, Method: Composition-based stats. Identities = 44/124 (35%), Positives = 71/124 (57%), Gaps = 10/124 (8%) Query 1 PPRRFRVNEDFVAYGSEKKDKDAAPQDKDGGGSHGR---------GGGAGDDVSIDSNSS 51 P +RFR+NED + + + ++ ++ P+ D + + + S S++S Sbjct 2681 PGKRFRINEDHIYFKNNERMENI-PEALDVNKKYYHIIQNKAEYYDNDSLSEFSYTSSNS 2739 Query 52 GVSFEGDKHRDHVKLVKVSHLINRFSLKFKDMQLEADYQIHQKKSFVKRLVPWYRVIFVF 111 ++ + ++VKVSHLINRF+L FKDMQLE+ +QIH+K F K PWYR IF+ Sbjct 2740 SINNKKKNENTQKEIVKVSHLINRFTLAFKDMQLESGFQIHKKNKFYKTFTPWYRFIFLL 2799 Query 112 LGLY 115 LG++ Sbjct 2800 LGVF 2803 Lambda K H 0.321 0.141 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22998535989 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40