bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2613_orf1 Length=120 Score E Sequences producing significant alignments: (Bits) Value 5085.AFUA_3G06030 162 3e-39 > 5085.AFUA_3G06030 Length=147 Score = 162 bits (409), Expect = 3e-39, Method: Compositional matrix adjust. Identities = 73/86 (84%), Positives = 80/86 (93%), Gaps = 0/86 (0%) Query 35 MALKRINKELNDLSKDPPTNCSAGPVGDDLFHWQATIMGPEDSPYSGGVFFLNIHFPSDY 94 MALKRINKEL DL +DPP++CSAGPVGDDLFHWQATIMGP DSPYSGGVFFL IHFP+DY Sbjct 1 MALKRINKELTDLGRDPPSSCSAGPVGDDLFHWQATIMGPGDSPYSGGVFFLTIHFPTDY 60 Query 95 PFKPPEVNFTTKIYHPNINGQGAICL 120 PFKPP+VNFTT+IYHPNIN G+ICL Sbjct 61 PFKPPKVNFTTRIYHPNINSNGSICL 86 Lambda K H 0.324 0.144 0.474 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23080484097 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40