bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2731_orf2 Length=141 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd6_750 101 6e-21 > 5807.cgd6_750 Length=340 Score = 101 bits (251), Expect = 6e-21, Method: Compositional matrix adjust. Identities = 53/130 (40%), Positives = 78/130 (60%), Gaps = 3/130 (2%) Query 1 WNPELFGNCPKLRELYLSHNNLPSPPS-EIGQLVELTVLDLCCNRIDDVGTIASLHQLQD 59 W+ N ++ELYLS N L SP L VLDL N+I ++ I+ + L++ Sbjct 208 WSINFSKNVNNVQELYLSDNQLISPDEVYFDSFQNLKVLDLGGNKIQNLEAISKIESLEE 267 Query 60 LWLNDNKLETVEKIRCLQHLSALDTLYLERNPLQASLGPGYRQAVTDLLPRLSQLDALSI 119 LW+NDN + + ++ L++L L TLYLERNP+Q LGP YR V ++P ++QLDA+ I Sbjct 268 LWINDNDICDINQLELLKNLRNLQTLYLERNPIQNQLGPAYRLTVIKIVPWITQLDAIPI 327 Query 120 --STTVHFVQ 127 S +HF+Q Sbjct 328 NRSGEIHFIQ 337 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22827922775 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40