bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2734_orf2 Length=170 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0336 104 1e-21 > 5833.PF11_0336 Length=386 Score = 104 bits (260), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 47/83 (56%), Positives = 58/83 (69%), Gaps = 0/83 (0%) Query 1 DFKYLRAVAVFYLRLVAASDEVYIHLEPLLTDYRKLRVRDNSGAFSLTYMDVFVDNCLRK 60 DF YLRA+ +FYLRL+ S EVY HLEP+L DYRK+R+R +G F YMDVFVDNCL Sbjct 95 DFVYLRALGIFYLRLIGKSLEVYNHLEPILFDYRKIRMRLQNGTFEKIYMDVFVDNCLIL 154 Query 61 NTLFDIDLPPIVKRKALVQQQLL 83 N D+D P + KR+ L + LL Sbjct 155 NNFLDVDFPTLTKRQVLEENNLL 177 Lambda K H 0.321 0.136 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 31617132627 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40