bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_3064_orf1 Length=142 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0122 121 8e-27 > 5833.PF11_0122 Length=779 Score = 121 bits (303), Expect = 8e-27, Method: Composition-based stats. Identities = 55/140 (39%), Positives = 89/140 (63%), Gaps = 2/140 (1%) Query 2 AYRAFSFTRINGSKGALTLVLKMYDQVVCFVGCHMPASGVKGRFRARQHIRQKLAQVYSY 61 A ++ +F ++N SKG ++++L +++Q V F+GCHMPA + R ++R+ I KL++ +S Sbjct 505 ASKSIAFNKLNNSKGCVSILLNIFNQFVLFIGCHMPAKDQEIRQKSREFILTKLSEYFSN 564 Query 62 SSEVDFTRVFHHVIWAGDFNFRLQA-SPEVYMPLLEKQDMESLLQYDESREDFGQDMVLH 120 S +F VFHHVIW GDFNFR+ E + L+ +++ LL++DE + D+ + Sbjct 565 KSTSNFKDVFHHVIWMGDFNFRVHGIHIEKVIHYLKTDNLKELLKHDEGHSAYSYDLSI- 623 Query 121 QMREAPVRFLPTYKKADGRP 140 +E P+ FLPTYKK RP Sbjct 624 SFQELPINFLPTYKKNGNRP 643 Lambda K H 0.326 0.139 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22741008115 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40