bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_3107_orf1 Length=144 Score E Sequences producing significant alignments: (Bits) Value 5833.PFL0895c 98.6 5e-20 > 5833.PFL0895c Length=1061 Score = 98.6 bits (244), Expect = 5e-20, Method: Compositional matrix adjust. Identities = 62/146 (42%), Positives = 91/146 (62%), Gaps = 3/146 (2%) Query 2 MPLYLLELFSLSLEEKEKGDFSTRKASMQRQMETGLKDVEHLLTTAFDPSPD---YQTLA 58 +PLYLLELFS+ +E+KEK DF T + SM ++ G K+V LL F+ + + L Sbjct 266 LPLYLLELFSIPIEQKEKNDFLTNRISMYSKILNGRKNVLDLLLNKFENDCNDSIKKELI 325 Query 59 DFFSPHKFKSELNNKFQALLSEQLSSLERRLTRKRRDTQKKIAELEDQLVQQSPQSIREY 118 D F KFK E+N+KF +L +QL +E +L +K+ +LE+ + + S+RE Sbjct 326 DCFDVEKFKQEVNSKFMNILIQQLRKVEVKLEKKKAKMDFYNKKLEELYNKGNILSVREQ 385 Query 119 VKLYLRELLQIVTELMTGNYVIIRLP 144 VKLY+REL+ IV+ L+TGNY I+ LP Sbjct 386 VKLYIRELVNIVSNLLTGNYPILNLP 411 Lambda K H 0.317 0.133 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22567178795 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40