bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_3202_orf2 Length=141 Score E Sequences producing significant alignments: (Bits) Value 5833.PFF1035w 163 1e-39 > 5833.PFF1035w Length=664 Score = 163 bits (413), Expect = 1e-39, Method: Compositional matrix adjust. Identities = 77/115 (66%), Positives = 101/115 (87%), Gaps = 0/115 (0%) Query 27 QKKIIERDVDVPVHVGYAPQFVPKWDIREVPRPVPKYEGEQQIIEVEVPQIEYKDTYVEK 86 Q+KIIE+ V+V + +GY P F P WD+RE+PR +PKYEGEQ+II+VE+PQI+Y D +VEK Sbjct 120 QEKIIEKPVEVDMPIGYTPVFSPTWDVREIPRVIPKYEGEQKIIQVEIPQIKYVDKFVEK 179 Query 87 EVVVDVKEKIVPKVTEVVKEVEVMQYEWKEKYQDVPVYKYVPKFDVELDCPPPLI 141 E++VD+KEKI+P++ EV KE++V++Y+WKEKYQDVPV KYVPK DVELDCPPPLI Sbjct 180 EIIVDIKEKIIPRINEVEKEIDVVKYKWKEKYQDVPVCKYVPKIDVELDCPPPLI 234 Lambda K H 0.320 0.141 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22827922775 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40