bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_3211_orf1 Length=145 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd2_1280 68.9 4e-11 > 5807.cgd2_1280 Length=685 Score = 68.9 bits (167), Expect = 4e-11, Method: Composition-based stats. Identities = 34/62 (54%), Positives = 44/62 (70%), Gaps = 1/62 (1%) Query 35 MPRRYDFQLQEDTAEHYLSSLALLNSHFNYFKLKDVAFFIL-KCLSGKNPLMSYTDHLQL 93 +P R D+QLQE T EHY+SSLA L SHFNY+K +D+ FFIL K + P++SY D+ Sbjct 594 IPIRVDYQLQEGTTEHYISSLAFLQSHFNYWKSRDLGFFILWKIIEDFEPVISYDDYRAA 653 Query 94 LE 95 LE Sbjct 654 LE 655 Lambda K H 0.314 0.126 0.340 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22480264135 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40