bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_0268_orf1 Length=117 Score E Sequences producing significant alignments: (Bits) Value Hs4759110 57.4 6e-09 7296917 50.8 5e-07 At5g59470 42.7 2e-04 At4g07390 42.0 3e-04 CE04527 37.7 0.006 7292466 33.1 0.13 Hs22067353 31.2 0.47 Hs20542541 28.1 3.6 At1g10080 27.3 6.4 7292211 27.3 7.2 > Hs4759110 Length=247 Score = 57.4 bits (137), Expect = 6e-09, Method: Compositional matrix adjust. Identities = 32/93 (34%), Positives = 55/93 (59%), Gaps = 1/93 (1%) Query 24 YDRWEL-SSACIKESAGLTLNVLILAGALIVKTPQLLNVFIAKSASGLSYWAILTEVFTA 82 + +W+L C+K L + I+AG+L+VK PQ+ + AKSA GLS +++ E+ Sbjct 27 FVQWDLLHVPCLKILLSKGLGLGIVAGSLLVKLPQVFKIRGAKSAEGLSLQSVMLELVAL 86 Query 83 ELVVGYNLLSKHPFSTWGEAVFIGAQNLVLLLL 115 + Y++ + PFS+WGEA+F+ Q + + L Sbjct 87 TGTMVYSITNNFPFSSWGEALFLMLQTITICFL 119 > 7296917 Length=197 Score = 50.8 bits (120), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 0/73 (0%) Query 29 LSSACIKESAGLTLNVLILAGALIVKTPQLLNVFIAKSASGLSYWAILTEVFTAELVVGY 88 L C K L + I+AG+++VK PQ+L + +KS G++ ++ ++ + Y Sbjct 28 LDVPCFKALLSKGLGLAIIAGSVLVKVPQVLKILNSKSGEGINIVGVVLDLLAISFHLSY 87 Query 89 NLLSKHPFSTWGE 101 N + +PFS WG+ Sbjct 88 NFMHGYPFSAWGD 100 > At5g59470 Length=239 Score = 42.7 bits (99), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 0/72 (0%) Query 42 LNVLILAGALIVKTPQLLNVFIAKSASGLSYWAILTEVFTAELVVGYNLLSKHPFSTWGE 101 L ++A ++ VK PQ++ + KS GLS A EV + + Y L PFS +GE Sbjct 34 LGYFLVAASMTVKLPQIMKIVDNKSVKGLSVVAFELEVIGYTISLAYCLNKDLPFSAFGE 93 Query 102 AVFIGAQNLVLL 113 F+ Q L+L+ Sbjct 94 LAFLLIQALILV 105 > At4g07390 Length=143 Score = 42.0 bits (97), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 0/71 (0%) Query 46 ILAGALIVKTPQLLNVFIAKSASGLSYWAILTEVFTAELVVGYNLLSKHPFSTWGEAVFI 105 ++A ++ VK PQ++ + KS GLS A EV + + Y L PFS +GE F+ Sbjct 38 LVAASITVKLPQIMKIVQHKSVRGLSVVAFELEVVGYTISLAYCLHKGLPFSAFGEMAFL 97 Query 106 GAQNLVLLLLY 116 Q +V L L+ Sbjct 98 LIQAVVFLNLF 108 > CE04527 Length=238 Score = 37.7 bits (86), Expect = 0.006, Method: Compositional matrix adjust. Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 0/82 (0%) Query 33 CIKESAGLTLNVLILAGALIVKTPQLLNVFIAKSASGLSYWAILTEVFTAELVVGYNLLS 92 C K L I G++++ PQ+L + A+SA G+S + L + A Y+ S Sbjct 28 CPKAVLSRGLGFAITLGSILLFVPQILKIQAARSAQGISAASQLLALVGAIGTASYSYRS 87 Query 93 KHPFSTWGEAVFIGAQNLVLLL 114 FS WG++ F+ Q ++++L Sbjct 88 GFVFSGWGDSFFVAVQLVIIIL 109 > 7292466 Length=182 Score = 33.1 bits (74), Expect = 0.13, Method: Compositional matrix adjust. Identities = 15/60 (25%), Positives = 36/60 (60%), Gaps = 0/60 (0%) Query 42 LNVLILAGALIVKTPQLLNVFIAKSASGLSYWAILTEVFTAELVVGYNLLSKHPFSTWGE 101 L+++ ++ L++K PQ+ + +S+ G+S + E+F+ +++ YN S + F ++ E Sbjct 25 LSLITVSSCLVIKVPQINTIRANESSKGISVLGLCLELFSYTVMLSYNYTSGYDFLSYME 84 > Hs22067353 Length=1571 Score = 31.2 bits (69), Expect = 0.47, Method: Composition-based stats. Identities = 24/81 (29%), Positives = 41/81 (50%), Gaps = 5/81 (6%) Query 39 GLTLNVLILAGA-LIVKTPQLLNVFIAKSASGLSYWAIL---TEVFTA-ELVVGYNLLSK 93 G + V+ L G + KT ++ + ++ SA+G +Y+ +L VF A + G + Sbjct 725 GANVCVVKLEGTPYLCKTDEVGEICVSSSATGTAYYGLLGITKNVFEAVPVTTGGAPIFD 784 Query 94 HPFSTWGEAVFIGAQNLVLLL 114 PF+ G FIG NLV ++ Sbjct 785 RPFTRTGLLGFIGPDNLVFIV 805 > Hs20542541 Length=164 Score = 28.1 bits (61), Expect = 3.6, Method: Compositional matrix adjust. Identities = 10/25 (40%), Positives = 13/25 (52%), Gaps = 0/25 (0%) Query 3 RMRLGYVLQSCGLASAGCAAAYDRW 27 R++ Y L C L GC A +D W Sbjct 22 RLQWAYPLWECSLLPMGCEAVFDPW 46 > At1g10080 Length=509 Score = 27.3 bits (59), Expect = 6.4, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Query 50 ALIVKTPQLLNVFIAKSASGLSYWAIL--TEVFT 81 A ++ Q++NV+I K SG YW + T +F+ Sbjct 320 AYLIYKNQIINVYITKYESGGQYWPVFHNTTIFS 353 > 7292211 Length=1180 Score = 27.3 bits (59), Expect = 7.2, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 9/54 (16%) Query 44 VLILAGALIVKTPQLLNVFI---AKSASGLSYWAILTEVFTAELVVGYNLLSKH 94 V ++ L++ TP++ V++ A SGL W +L F +ELV SKH Sbjct 75 VTVIHTLLLLTTPEIKYVYVDMVAYMCSGLVIWVVLGVNFRSELV------SKH 122 Lambda K H 0.324 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1171470346 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40