bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_0613_orf1 Length=135 Score E Sequences producing significant alignments: (Bits) Value At5g39500 46.6 1e-05 At1g13980 44.3 6e-05 YJR031c 43.9 8e-05 SPBC211.03c 43.5 1e-04 CE19701 43.1 2e-04 At5g19610 42.7 2e-04 YEL022w 42.4 2e-04 YDR170c 39.3 0.002 At4g35380 37.7 0.006 At3g43300 37.4 0.008 SPAC4D7.01c 37.0 0.010 Hs5453573 36.6 0.013 Hs5453571 36.6 0.013 At4g38200 36.6 0.014 Hs4758416 36.2 0.018 7298092 35.8 0.021 At3g60860 35.8 0.022 At1g01960 35.8 0.023 7296387 35.4 0.030 7303476 35.0 0.042 Hs7019505 34.3 0.059 Hs4758968 33.5 0.11 SPAC30.01c 33.5 0.11 Hs7662290 33.5 0.12 Hs4758964 33.1 0.15 Hs8670544 33.1 0.15 7302131 33.1 0.16 Hs14767357 32.7 0.20 Hs8670546 32.7 0.20 Hs4758966 32.7 0.21 Hs14764245 32.7 0.21 CE12328 32.7 0.22 CE24576 32.0 0.29 At4g18040 32.0 0.35 At1g75140 31.2 0.60 Hs21450798 29.3 2.1 Hs18590355 28.9 3.1 YPL029w 28.1 4.9 7296183 28.1 4.9 Hs5031843 27.3 7.9 > At5g39500 Length=1443 Score = 46.6 bits (109), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 3/50 (6%) Query 76 LMVHKDTVFVLSYSIIMLNTDQHNSQVAVGC---EWRTSSRTIEASTTDP 122 +++ KD FVL+YSII+LNTDQHN+QV ++ ++RTI P Sbjct 680 ILIDKDAAFVLAYSIILLNTDQHNAQVKTRMTEEDFIRNNRTINGGADLP 729 > At1g13980 Length=1451 Score = 44.3 bits (103), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 0/27 (0%) Query 76 LMVHKDTVFVLSYSIIMLNTDQHNSQV 102 ++ +KD VLSYSIIMLNTDQHN QV Sbjct 680 ILANKDAALVLSYSIIMLNTDQHNVQV 706 > YJR031c Length=1408 Score = 43.9 bits (102), Expect = 8e-05, Method: Composition-based stats. Identities = 19/22 (86%), Positives = 20/22 (90%), Gaps = 0/22 (0%) Query 81 DTVFVLSYSIIMLNTDQHNSQV 102 D+VFVLSYSIIMLNTD HN QV Sbjct 688 DSVFVLSYSIIMLNTDSHNPQV 709 > SPBC211.03c Length=1462 Score = 43.5 bits (101), Expect = 1e-04, Method: Composition-based stats. Identities = 19/26 (73%), Positives = 20/26 (76%), Gaps = 0/26 (0%) Query 77 MVHKDTVFVLSYSIIMLNTDQHNSQV 102 M KD FVLSYSIIMLNTDQHN + Sbjct 666 MSSKDAAFVLSYSIIMLNTDQHNPNI 691 > CE19701 Length=1820 Score = 43.1 bits (100), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 23/53 (43%), Positives = 27/53 (50%), Gaps = 7/53 (13%) Query 77 MVHKDTVFVLSYSIIMLNTDQHNSQ-------VAVGCEWRTSSRTIEASTTDP 122 H D F LSY+IIMLN DQHN Q + V C R S T ++ DP Sbjct 777 FFHVDAAFTLSYAIIMLNVDQHNPQAKRSQPPMTVDCFRRNLSGTNDSRDFDP 829 > At5g19610 Length=1375 Score = 42.7 bits (99), Expect = 2e-04, Method: Composition-based stats. Identities = 18/27 (66%), Positives = 21/27 (77%), Gaps = 0/27 (0%) Query 76 LMVHKDTVFVLSYSIIMLNTDQHNSQV 102 + KDTV +L YS+IMLNTDQHN QV Sbjct 613 IFASKDTVHILCYSLIMLNTDQHNPQV 639 > YEL022w Length=1459 Score = 42.4 bits (98), Expect = 2e-04, Method: Composition-based stats. Identities = 18/22 (81%), Positives = 20/22 (90%), Gaps = 0/22 (0%) Query 81 DTVFVLSYSIIMLNTDQHNSQV 102 D+VF+LSYSIIMLNTD HN QV Sbjct 696 DSVFILSYSIIMLNTDLHNPQV 717 > YDR170c Length=2009 Score = 39.3 bits (90), Expect = 0.002, Method: Composition-based stats. Identities = 16/22 (72%), Positives = 20/22 (90%), Gaps = 0/22 (0%) Query 81 DTVFVLSYSIIMLNTDQHNSQV 102 DT +VLSYS+IMLNTD H+SQ+ Sbjct 950 DTAYVLSYSLIMLNTDLHSSQI 971 > At4g35380 Length=1711 Score = 37.7 bits (86), Expect = 0.006, Method: Composition-based stats. Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%) Query 81 DTVFVLSYSIIMLNTDQHNSQV 102 DT +VL+YS+IMLNTD HN+ V Sbjct 689 DTAYVLAYSVIMLNTDAHNNMV 710 > At3g43300 Length=1669 Score = 37.4 bits (85), Expect = 0.008, Method: Compositional matrix adjust. Identities = 17/31 (54%), Positives = 22/31 (70%), Gaps = 2/31 (6%) Query 72 PGYVLMVHKDTVFVLSYSIIMLNTDQHNSQV 102 PG L + DT +VL+Y++IMLNTD HN V Sbjct 659 PG--LFKNADTAYVLAYAVIMLNTDAHNPMV 687 > SPAC4D7.01c Length=1811 Score = 37.0 bits (84), Expect = 0.010, Method: Composition-based stats. Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%) Query 81 DTVFVLSYSIIMLNTDQHNSQV 102 DT ++L+YSIIMLNTD H+ QV Sbjct 822 DTAYILAYSIIMLNTDLHSPQV 843 > Hs5453573 Length=1785 Score = 36.6 bits (83), Expect = 0.013, Method: Compositional matrix adjust. Identities = 17/30 (56%), Positives = 20/30 (66%), Gaps = 0/30 (0%) Query 73 GYVLMVHKDTVFVLSYSIIMLNTDQHNSQV 102 G L DT +VL+YSIIML TD H+ QV Sbjct 759 GQTLFASADTAYVLAYSIIMLTTDLHSPQV 788 > Hs5453571 Length=1849 Score = 36.6 bits (83), Expect = 0.013, Method: Compositional matrix adjust. Identities = 17/30 (56%), Positives = 20/30 (66%), Gaps = 0/30 (0%) Query 73 GYVLMVHKDTVFVLSYSIIMLNTDQHNSQV 102 G L DT +VL+YSIIML TD H+ QV Sbjct 814 GQTLFASADTAYVLAYSIIMLTTDLHSPQV 843 > At4g38200 Length=1698 Score = 36.6 bits (83), Expect = 0.014, Method: Composition-based stats. Identities = 15/22 (68%), Positives = 18/22 (81%), Gaps = 0/22 (0%) Query 81 DTVFVLSYSIIMLNTDQHNSQV 102 DT +VL+YS+IMLNTD HN V Sbjct 672 DTAYVLAYSVIMLNTDAHNIMV 693 > Hs4758416 Length=1859 Score = 36.2 bits (82), Expect = 0.018, Method: Compositional matrix adjust. Identities = 14/24 (58%), Positives = 18/24 (75%), Gaps = 0/24 (0%) Query 79 HKDTVFVLSYSIIMLNTDQHNSQV 102 + D F L+Y++IMLNTDQHN V Sbjct 819 NSDACFSLAYAVIMLNTDQHNHNV 842 > 7298092 Length=1643 Score = 35.8 bits (81), Expect = 0.021, Method: Composition-based stats. Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 5/50 (10%) Query 53 RSSEDLARQLAEYTPTQPPPGYVLMVHKDTVFVLSYSIIMLNTDQHNSQV 102 R E A + E P L DTV+VL++SIIML TD H+ QV Sbjct 673 RLMEKFASRYCECNPKNQ-----LFQSADTVYVLAFSIIMLTTDLHSPQV 717 > At3g60860 Length=1793 Score = 35.8 bits (81), Expect = 0.022, Method: Composition-based stats. Identities = 14/22 (63%), Positives = 18/22 (81%), Gaps = 0/22 (0%) Query 81 DTVFVLSYSIIMLNTDQHNSQV 102 D+ +VL+YS+IMLNTD HN V Sbjct 739 DSAYVLAYSVIMLNTDAHNPMV 760 > At1g01960 Length=1750 Score = 35.8 bits (81), Expect = 0.023, Method: Composition-based stats. Identities = 14/22 (63%), Positives = 18/22 (81%), Gaps = 0/22 (0%) Query 81 DTVFVLSYSIIMLNTDQHNSQV 102 DT +VL+YS+I+LNTD HN V Sbjct 730 DTAYVLAYSVILLNTDAHNPMV 751 > 7296387 Length=1210 Score = 35.4 bits (80), Expect = 0.030, Method: Compositional matrix adjust. Identities = 13/18 (72%), Positives = 17/18 (94%), Gaps = 0/18 (0%) Query 81 DTVFVLSYSIIMLNTDQH 98 DT+FVL+++IIMLNTD H Sbjct 777 DTIFVLAFAIIMLNTDLH 794 > 7303476 Length=2040 Score = 35.0 bits (79), Expect = 0.042, Method: Compositional matrix adjust. Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 0/21 (0%) Query 81 DTVFVLSYSIIMLNTDQHNSQ 101 D F L+Y+IIMLN DQHNS Sbjct 767 DAAFRLAYAIIMLNMDQHNSN 787 > Hs7019505 Length=394 Score = 34.3 bits (77), Expect = 0.059, Method: Compositional matrix adjust. Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 0/22 (0%) Query 81 DTVFVLSYSIIMLNTDQHNSQV 102 DT +VLS+SIIMLNT HN V Sbjct 183 DTCYVLSFSIIMLNTSLHNPNV 204 > Hs4758968 Length=399 Score = 33.5 bits (75), Expect = 0.11, Method: Compositional matrix adjust. Identities = 14/22 (63%), Positives = 17/22 (77%), Gaps = 0/22 (0%) Query 81 DTVFVLSYSIIMLNTDQHNSQV 102 DT +VLS++IIMLNT HN V Sbjct 188 DTCYVLSFAIIMLNTSLHNHNV 209 > SPAC30.01c Length=1822 Score = 33.5 bits (75), Expect = 0.11, Method: Composition-based stats. Identities = 12/22 (54%), Positives = 19/22 (86%), Gaps = 0/22 (0%) Query 81 DTVFVLSYSIIMLNTDQHNSQV 102 DT ++L+YSII+LNTD H+ ++ Sbjct 831 DTAYILAYSIILLNTDLHSPRI 852 > Hs7662290 Length=841 Score = 33.5 bits (75), Expect = 0.12, Method: Compositional matrix adjust. Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Query 72 PGYVLMVHK-DTVFVLSYSIIMLNTDQHNSQV 102 PG V DT+F+L+++II+LNTD ++ V Sbjct 518 PGVVRQFRNPDTIFILAFAIILLNTDMYSPNV 549 > Hs4758964 Length=398 Score = 33.1 bits (74), Expect = 0.15, Method: Compositional matrix adjust. Identities = 14/22 (63%), Positives = 17/22 (77%), Gaps = 0/22 (0%) Query 81 DTVFVLSYSIIMLNTDQHNSQV 102 DT +VLS++IIMLNT HN V Sbjct 184 DTCYVLSFAIIMLNTSLHNPNV 205 > Hs8670544 Length=397 Score = 33.1 bits (74), Expect = 0.15, Method: Compositional matrix adjust. Identities = 14/22 (63%), Positives = 17/22 (77%), Gaps = 0/22 (0%) Query 81 DTVFVLSYSIIMLNTDQHNSQV 102 DT +VLS++IIMLNT HN V Sbjct 184 DTCYVLSFAIIMLNTSLHNPNV 205 > 7302131 Length=348 Score = 33.1 bits (74), Expect = 0.16, Method: Compositional matrix adjust. Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 7/50 (14%) Query 53 RSSEDLARQLAEYTPTQPPPGYVLMVHKDTVFVLSYSIIMLNTDQHNSQV 102 R E A++ + P + + DT +VLS++IIMLNT HN V Sbjct 116 RMMETFAQRYCQLNPD-------IFTNTDTCYVLSFAIIMLNTSLHNPSV 158 > Hs14767357 Length=701 Score = 32.7 bits (73), Expect = 0.20, Method: Compositional matrix adjust. Identities = 13/32 (40%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Query 72 PGYVLMVHK-DTVFVLSYSIIMLNTDQHNSQV 102 P V H DT+F+L+++II+LNTD ++ + Sbjct 286 PEVVQQFHNPDTIFILAFAIILLNTDMYSPNI 317 > Hs8670546 Length=400 Score = 32.7 bits (73), Expect = 0.20, Method: Compositional matrix adjust. Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%) Query 81 DTVFVLSYSIIMLNTDQHNSQV 102 DT +VLS+++IMLNT HN V Sbjct 183 DTCYVLSFAVIMLNTSLHNPNV 204 > Hs4758966 Length=399 Score = 32.7 bits (73), Expect = 0.21, Method: Compositional matrix adjust. Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%) Query 81 DTVFVLSYSIIMLNTDQHNSQV 102 DT +VLS+++IMLNT HN V Sbjct 183 DTCYVLSFAVIMLNTSLHNPNV 204 > Hs14764245 Length=1488 Score = 32.7 bits (73), Expect = 0.21, Method: Compositional matrix adjust. Identities = 11/22 (50%), Positives = 19/22 (86%), Gaps = 0/22 (0%) Query 81 DTVFVLSYSIIMLNTDQHNSQV 102 DT+F+L+++II+LNTD ++ V Sbjct 879 DTIFILAFAIILLNTDMYSPSV 900 > CE12328 Length=614 Score = 32.7 bits (73), Expect = 0.22, Method: Compositional matrix adjust. Identities = 13/22 (59%), Positives = 18/22 (81%), Gaps = 0/22 (0%) Query 81 DTVFVLSYSIIMLNTDQHNSQV 102 DT+ +LS++IIMLNTD H+ V Sbjct 325 DTIHLLSFAIIMLNTDLHSPNV 346 > CE24576 Length=1628 Score = 32.0 bits (71), Expect = 0.29, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Query 63 AEYTPTQPPPGYVLMVHKDTVFVLSYSIIMLNTDQHNSQV 102 + Y P G + D +VL++SIIML TD HN V Sbjct 621 SRYLDCNPRQG--IFASADAAYVLAFSIIMLTTDLHNKTV 658 > At4g18040 Length=235 Score = 32.0 bits (71), Expect = 0.35, Method: Compositional matrix adjust. Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 5/56 (8%) Query 85 VLSYSII-----MLNTDQHNSQVAVGCEWRTSSRTIEASTTDPICPHSSSKTYTFP 135 V ++S + + N +H S++A G ++ IE DPIC + T TFP Sbjct 89 VFTFSTVEEFWSLYNNMKHPSKLAHGADFYCFKHIIEPKWEDPICANGGKWTMTFP 144 > At1g75140 Length=617 Score = 31.2 bits (69), Expect = 0.60, Method: Compositional matrix adjust. Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Query 49 KCRQRSSEDLARQLAEYTPTQPPPGYVLMVHKDTVFVLSYS 89 KCR RS + + Q+ E Q GY+L+V+++ VFV + S Sbjct 354 KCRVRSKKKV--QMEEPVALQAIKGYLLIVNQEKVFVYNVS 392 > Hs21450798 Length=421 Score = 29.3 bits (64), Expect = 2.1, Method: Composition-based stats. Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 10/69 (14%) Query 4 GPR-GFSLTCAAAAAEPQELSLWRWVADEGSYSLLRAAAVREGAVDKCRQRSSEDLARQL 62 GP GF L E ++ +L R +E SY ++ A ++ Q+ SE+LAR + Sbjct 345 GPEPGFRLNLFTTDEEEEQAALTR--PEELSYEVINIQATQD-------QQRSEELARIM 395 Query 63 AEYTPTQPP 71 E+ T+ P Sbjct 396 GEFEITEQP 404 > Hs18590355 Length=559 Score = 28.9 bits (63), Expect = 3.1, Method: Compositional matrix adjust. Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 5/29 (17%) Query 3 KGPRGFSLTCAA----AAAEP-QELSLWR 26 KGP GF +TCA AA +P QE +W+ Sbjct 38 KGPYGFGITCAGFQLSAATKPDQEFKVWK 66 > YPL029w Length=737 Score = 28.1 bits (61), Expect = 4.9, Method: Composition-based stats. Identities = 20/63 (31%), Positives = 26/63 (41%), Gaps = 4/63 (6%) Query 74 YVLMVHKDTVFVLSYSIIMLNTDQ----HNSQVAVGCEWRTSSRTIEASTTDPICPHSSS 129 +VL D V+ +M NTD HN + EW +R I I P +S Sbjct 185 HVLQQTFDHVYEQEILPMMTNTDDTDGAHNVDITNPAEWFPEARKIRRHIIMHIGPTNSG 244 Query 130 KTY 132 KTY Sbjct 245 KTY 247 > 7296183 Length=212 Score = 28.1 bits (61), Expect = 4.9, Method: Compositional matrix adjust. Identities = 18/93 (19%), Positives = 44/93 (47%), Gaps = 2/93 (2%) Query 26 RWVADEGSYSLLRAAAVREGAVDKCRQRSSEDLARQLAEYTPTQPPPGYVLMVHKDTVFV 85 ++ +DEG ++ ++ A ++ RS+ + L ++P+ P P + MV + Sbjct 44 QYASDEGLDEMVGLRSLEHRAEEQQPDRSTSKMLSALFGFSPSTPHPTEMAMVMPHQLPP 103 Query 86 LSYSIIM--LNTDQHNSQVAVGCEWRTSSRTIE 116 + Y+ L T + N + GC+ + ++ ++ Sbjct 104 MYYNDFYEDLVTTKRNDVHSAGCDCKVTNELVD 136 > Hs5031843 Length=469 Score = 27.3 bits (59), Expect = 7.9, Method: Composition-based stats. Identities = 11/29 (37%), Positives = 19/29 (65%), Gaps = 0/29 (0%) Query 37 LRAAAVREGAVDKCRQRSSEDLARQLAEY 65 L+ A ++ ++ QR+ +D+ARQL EY Sbjct 347 LKDARAKQEELEAALQRAKQDMARQLREY 375 Lambda K H 0.316 0.128 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1388795348 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40