bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_0711_orf1 Length=156 Score E Sequences producing significant alignments: (Bits) Value CE05905 35.0 0.052 Hs22059237 33.5 0.18 CE23800 31.6 0.58 Hs22059233 31.6 0.70 CE05901 31.6 0.74 CE17356 30.8 1.0 At4g31470 30.4 1.3 At5g66900 29.6 2.2 Hs5803151 29.6 2.4 CE20952 29.6 2.4 Hs10198656 29.6 2.6 Hs13899332 29.3 3.1 Hs13899303 28.9 4.1 CE05388 28.1 6.8 CE23548 28.1 7.2 At1g50050 28.1 7.2 CE05907 28.1 7.7 > CE05905 Length=207 Score = 35.0 bits (79), Expect = 0.052, Method: Compositional matrix adjust. Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 0/48 (0%) Query 101 LLWSESTKIACAVGVCTDDTPLPSGKEAILVCQFSPAAQENAAPFSKE 148 + W+ ++ I C V C D + + + +VCQ+SP P KE Sbjct 139 MAWANTSSIGCGVKNCGRDASMRNMNKIAVVCQYSPPGNTMGRPIYKE 186 > Hs22059237 Length=344 Score = 33.5 bits (75), Expect = 0.18, Method: Compositional matrix adjust. Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query 94 DGANLANLLWSESTKIACAVGVCTDDTPLPSGKEAILVCQFSPAAQENAAPFS 146 D +N L+W S K+ CAV C+ + AI +C ++P P+ Sbjct 154 DCSNYIQLVWDHSYKVGCAVTPCSKIGHIIHA--AIFICNYAPGGTLTRRPYE 204 > CE23800 Length=208 Score = 31.6 bits (70), Expect = 0.58, Method: Compositional matrix adjust. Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 0/37 (0%) Query 101 LLWSESTKIACAVGVCTDDTPLPSGKEAILVCQFSPA 137 + W+E+ KI C V C D+ + + + +VCQ+ A Sbjct 140 MAWAETNKIGCGVKNCGKDSSMNNMYKVAVVCQYDQA 176 > Hs22059233 Length=233 Score = 31.6 bits (70), Expect = 0.70, Method: Compositional matrix adjust. Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Query 96 ANLANLLWSESTKIACAVGVCTDDTPLPSGKEAILVCQFSPAAQ-ENAAPFSK 147 + L+W+ S + CAV +C + L AI VC + PA N P+ + Sbjct 136 GHYTQLVWANSFYVGCAVAMCPN---LGGASTAIFVCNYGPAGNFANMPPYVR 185 > CE05901 Length=212 Score = 31.6 bits (70), Expect = 0.74, Method: Compositional matrix adjust. Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Query 101 LLWSESTKIACAVGVCTDDTPLPSGKEAILVCQFSPAA 138 + W+ + KI C + C+ D+ G + ++VC +SPA Sbjct 147 MAWATTNKIGCGISKCSSDS---FGTQYVVVCLYSPAG 181 > CE17356 Length=241 Score = 30.8 bits (68), Expect = 1.0, Method: Compositional matrix adjust. Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Query 100 NLLWSESTKIACAVGVC--TDDTPLPSGKEAILVCQFSP 136 +LW E+ K+ CAV C D L K + VC++ P Sbjct 155 QILWKETRKLGCAVQECPARQDGSLDGQKYNVAVCKYYP 193 > At4g31470 Length=185 Score = 30.4 bits (67), Expect = 1.3, Method: Compositional matrix adjust. Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 9/55 (16%) Query 91 SNPDGANLANLLWSESTKIACAVGVC-TDDTPLPSGKEAILVCQFSPAAQENAAP 144 +N D + L+W +S++I CA+ C T DT ++C + P P Sbjct 137 ANGDCLHYTQLVWKKSSRIGCAISFCKTGDT--------FIICNYDPPGNIVGQP 183 > At5g66900 Length=809 Score = 29.6 bits (65), Expect = 2.2, Method: Composition-based stats. Identities = 23/61 (37%), Positives = 30/61 (49%), Gaps = 8/61 (13%) Query 15 DDMVKTLKTALGDGTGLST--SDTCDNMALGASLK-LTFNVKFTQETSKTPNYRDMVQTA 71 DD V TL + G G +T S CD+ + K + FNV S TPN+R +VQ Sbjct 184 DDSVVTLVVSAPPGCGKTTLVSRLCDDPDIKGKFKHIFFNV-----VSNTPNFRVIVQNL 238 Query 72 L 72 L Sbjct 239 L 239 > Hs5803151 Length=266 Score = 29.6 bits (65), Expect = 2.4, Method: Compositional matrix adjust. Identities = 14/57 (24%), Positives = 26/57 (45%), Gaps = 9/57 (15%) Query 96 ANLANLLWSESTKIACAVGVCTDDTPLPSGKEAI-----LVCQFSPAAQENAAPFSK 147 + ++W++S K+ CAV C P SG +A+ +C + P P+ + Sbjct 136 GHYTQVVWADSYKVGCAVQFC----PKVSGFDALSNGAHFICNYGPGGNYPTWPYKR 188 > CE20952 Length=208 Score = 29.6 bits (65), Expect = 2.4, Method: Compositional matrix adjust. Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 0/38 (0%) Query 100 NLLWSESTKIACAVGVCTDDTPLPSGKEAILVCQFSPA 137 + W+E++KI C + C D + + +VCQ+ A Sbjct 139 QMAWAETSKIGCGIKNCGKDANKKNMYKVAVVCQYDSA 176 > Hs10198656 Length=573 Score = 29.6 bits (65), Expect = 2.6, Method: Composition-based stats. Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Query 50 FNVKFTQETSKTPNYRDMVQTALNKGLGQLPTYPSTWNAFWSNPDG 95 F + + E TP ++ A+ + + P PSTW F ++PDG Sbjct 436 FQLAYEAELGNTPTSDELWALAVQER--RRPYIPSTWRCFATDPDG 479 > Hs13899332 Length=497 Score = 29.3 bits (64), Expect = 3.1, Method: Composition-based stats. Identities = 19/61 (31%), Positives = 26/61 (42%), Gaps = 6/61 (9%) Query 82 YPSTWNAFW----SNPDGANLANLLWSESTKIACAVGVCTDDTPLPSGKE--AILVCQFS 135 YPS N + S P + ++W+ + KI CAV C T E VC +S Sbjct 142 YPSECNPWCPERCSGPMCTHYTQIVWATTNKIGCAVNTCRKMTVWGEVWENAVYFVCNYS 201 Query 136 P 136 P Sbjct 202 P 202 > Hs13899303 Length=500 Score = 28.9 bits (63), Expect = 4.1, Method: Composition-based stats. Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query 91 SNPDGANLANLLWSESTKIACAVGVCTDDTPLPS--GKEAILVCQFSP 136 S P + ++W+ S +I CA+ +C + K LVC +SP Sbjct 161 SGPVCTHYTQVVWATSNRIGCAINLCHNMNIWGQIWPKAVYLVCNYSP 208 > CE05388 Length=209 Score = 28.1 bits (61), Expect = 6.8, Method: Compositional matrix adjust. Identities = 19/90 (21%), Positives = 39/90 (43%), Gaps = 9/90 (10%) Query 51 NVKFTQETSKTPNYRDMVQTALNKGLGQLPTYPSTWN------AFWSNPDGANLANLLWS 104 N+ + +S + VQ+A++ + + + WN A W+ G + + WS Sbjct 88 NLFWAYSSSPITDLDKYVQSAVDTWVSEFQMFG--WNSNKFTTALWNTGIG-HATQVAWS 144 Query 105 ESTKIACAVGVCTDDTPLPSGKEAILVCQF 134 + ++ C C D+ +A +VCQ+ Sbjct 145 ATGQVGCGAKNCGADSVRVGSYKATIVCQY 174 > CE23548 Length=404 Score = 28.1 bits (61), Expect = 7.2, Method: Compositional matrix adjust. Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 0/43 (0%) Query 7 RINEVTKADDMVKTLKTALGDGTGLSTSDTCDNMALGASLKLT 49 RI E TK + + +G+G +S S CD + +G + +T Sbjct 330 RIGEKTKLKESIIAKGVVIGNGASISNSIICDGVEIGENADVT 372 > At1g50050 Length=226 Score = 28.1 bits (61), Expect = 7.2, Method: Compositional matrix adjust. Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 0/48 (0%) Query 71 ALNKGLGQLPTYPSTWNAFWSNPDGANLANLLWSESTKIACAVGVCTD 118 A+N + + P Y T NA + ++WS S KI CA +C + Sbjct 94 AVNLWVNEKPYYNYTANACIGAQQCKHYTQVVWSNSVKIGCARVLCNN 141 > CE05907 Length=211 Score = 28.1 bits (61), Expect = 7.7, Method: Compositional matrix adjust. Identities = 12/44 (27%), Positives = 21/44 (47%), Gaps = 0/44 (0%) Query 91 SNPDGANLANLLWSESTKIACAVGVCTDDTPLPSGKEAILVCQF 134 +N + + W+ + I C V C D L + A++VCQ+ Sbjct 133 ANTGIGHATQMAWANTGLIGCGVKNCGPDPELNNYNRAVVVCQY 176 Lambda K H 0.313 0.127 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2070320142 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40