bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_0824_orf2 Length=153 Score E Sequences producing significant alignments: (Bits) Value YIL015w 33.1 0.19 At2g38780 31.6 0.54 7292867 30.4 1.3 Hs4503145 30.4 1.4 Hs4758278 29.6 2.5 CE21683 29.3 2.9 At1g62290 29.3 3.2 7295835 28.9 4.4 Hs21265037 28.1 6.5 Hs22063872 28.1 7.1 Hs22063875 28.1 7.4 > YIL015w Length=587 Score = 33.1 bits (74), Expect = 0.19, Method: Composition-based stats. Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 7/52 (13%) Query 89 PNLHFLVPESTHPFADLPFDGLVGLGFP---DVSGEEGLPSSALPIVDQMVK 137 PN+ F V + +A P G++G+GFP V G EG P+ P Q++K Sbjct 153 PNIQFGVAK----YATTPVSGVLGIGFPRRESVKGYEGAPNEYYPNFPQILK 200 > At2g38780 Length=435 Score = 31.6 bits (70), Expect = 0.54, Method: Compositional matrix adjust. Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 5/47 (10%) Query 111 VGLGFPDVSGEEGLPSSALPIVDQM----VKEVCYCCDETQSRFAQH 153 +GLGF D GLP+ +P+VD + + EV + + ++RFA+ Sbjct 149 MGLGFADKKSTRGLPAGLVPVVDYLPEGDLPEVEFIVGD-KTRFAEK 194 > 7292867 Length=153 Score = 30.4 bits (67), Expect = 1.3, Method: Compositional matrix adjust. Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 8/43 (18%) Query 89 PNLHFLVPESTHPFADLPFDGLVGLGFPDVSGEEGLPSSALPI 131 P LHF +P S+HP +PF LG P+ G+ L + +P+ Sbjct 62 PVLHFYIPSSSHP---IPF-----LGMPNTRGQTPLDAPCMPV 96 > Hs4503145 Length=396 Score = 30.4 bits (67), Expect = 1.4, Method: Compositional matrix adjust. Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 5/44 (11%) Query 95 VPESTHPFADLPFDGLVGLGFPDVSGEEGLPSSALPIVDQMVKE 138 V E F D FDG++GLG+P ++ P+ D M+ + Sbjct 169 VTEPGQTFVDAEFDGILGLGYPSLA-----VGGVTPVFDNMMAQ 207 > Hs4758278 Length=976 Score = 29.6 bits (65), Expect = 2.5, Method: Compositional matrix adjust. Identities = 24/77 (31%), Positives = 32/77 (41%), Gaps = 4/77 (5%) Query 51 NHFVRSETPSFCSSAKCPTRQSAWQSKVRLQYFTTELKPNLHFLV--PESTHPFADLPFD 108 N R TP C SA WQ + + ++ L L+ P+S AD FD Sbjct 831 NDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLAD--FD 888 Query 109 GLVGLGFPDVSGEEGLP 125 V + P SG EG+P Sbjct 889 PRVSIRLPSTSGSEGVP 905 > CE21683 Length=320 Score = 29.3 bits (64), Expect = 2.9, Method: Compositional matrix adjust. Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 3/53 (5%) Query 90 NLHFLVPES-THPFADLPFDGLVGLGFPDVSGEEGLP--SSALPIVDQMVKEV 139 N F V E+ FA+ P DG++GLG+P ++ ++ P + LP +D V V Sbjct 160 NQEFGVAETLASVFAEQPVDGILGLGWPALADDKVTPPMQNLLPQLDAKVFTV 212 > At1g62290 Length=526 Score = 29.3 bits (64), Expect = 3.2, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 14/58 (24%) Query 81 QYFTTELKPNLHFLVPESTHPFADLPFDGLVGLGFPDVSGEEGLPSSALPIVDQMVKE 138 ++ T +P L FLV + FDGL+GLGF +++ +A P+ M+K+ Sbjct 176 EFIETTSEPGLTFLVAK---------FDGLLGLGFQEIA-----VGNATPVWYNMLKQ 219 > 7295835 Length=345 Score = 28.9 bits (63), Expect = 4.4, Method: Compositional matrix adjust. Identities = 26/79 (32%), Positives = 30/79 (37%), Gaps = 13/79 (16%) Query 27 FSTELEHAFFEWVATSWRSAACKKNHFVRSETPSFCSSAKCPTRQSAWQSKVRLQYFTTE 86 S+ EHA E + T R + H R +FCS A C VR Q T Sbjct 175 MSSTSEHAVKEELRTKARQLSRNSTHTCRLCNKTFCSKASC----------VRHQKTHTG 224 Query 87 LKPNLHFLVPESTHPFADL 105 KP F PFADL Sbjct 225 EKP---FACEICQKPFADL 240 > Hs21265037 Length=1205 Score = 28.1 bits (61), Expect = 6.5, Method: Compositional matrix adjust. Identities = 19/80 (23%), Positives = 32/80 (40%), Gaps = 15/80 (18%) Query 2 ETQQSHSFKCVLHTSRLQEIPLNGLFSTELEHAFFEWVATSWRSA-------------AC 48 +T+ S ++K ++H + I N + EL+ FEW SW C Sbjct 815 DTRSSLTYKYIIHEDSVPTINSNNVIQEELD--TFEWALKSWSQCSKPCGGGFQYTKYGC 872 Query 49 KKNHFVRSETPSFCSSAKCP 68 ++ + SFC + K P Sbjct 873 RRKSDNKMVHRSFCEANKKP 892 > Hs22063872 Length=325 Score = 28.1 bits (61), Expect = 7.1, Method: Compositional matrix adjust. Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 5/30 (16%) Query 106 PFDGLVGLGFPDVSGEEGLPSSALPIVDQM 135 PFDG++GL +P +S S A P+ D + Sbjct 115 PFDGILGLAYPSISS-----SGATPVFDNI 139 > Hs22063875 Length=325 Score = 28.1 bits (61), Expect = 7.4, Method: Compositional matrix adjust. Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 5/30 (16%) Query 106 PFDGLVGLGFPDVSGEEGLPSSALPIVDQM 135 PFDG++GL +P +S S A P+ D + Sbjct 115 PFDGILGLAYPSISS-----SGATPVFDNI 139 Lambda K H 0.321 0.132 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1961355924 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40