bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_1079_orf2 Length=135 Score E Sequences producing significant alignments: (Bits) Value YKL116c 42.0 3e-04 At1g53050 35.8 0.025 CE24774 34.3 0.063 Hs14770402 33.5 0.11 7292540 33.5 0.13 At1g09000 33.1 0.16 At5g11410 32.7 0.18 At2g43830 32.7 0.19 Hs6382062 32.3 0.24 Hs6382060 32.3 0.26 At1g54960 32.3 0.28 CE29341 32.0 0.34 At3g06030 32.0 0.37 At5g50000 31.6 0.45 CE28667 31.6 0.45 SPBC337.04 31.6 0.47 CE27768 30.4 1.1 CE23838 30.0 1.2 7302464 30.0 1.4 At5g66790 28.5 3.5 > YKL116c Length=518 Score = 42.0 bits (97), Expect = 3e-04, Method: Composition-based stats. Identities = 26/68 (38%), Positives = 38/68 (55%), Gaps = 12/68 (17%) Query 4 EETVSLQE--LQQEVQQLQSLDHPCIVKLLGVSLLSSSCCCSAPLPAAAKPQPCCSNLYP 61 +ET+S E L +E+Q L+SL+HPCIVKLLG+ + P+ +K +P C + Sbjct 246 KETLSRLENSLTRELQVLKSLNHPCIVKLLGI---------NNPIFVTSK-KPLCDLIIK 295 Query 62 CPSTPPYC 69 P P C Sbjct 296 TPRALPPC 303 > At1g53050 Length=694 Score = 35.8 bits (81), Expect = 0.025, Method: Compositional matrix adjust. Identities = 17/39 (43%), Positives = 26/39 (66%), Gaps = 2/39 (5%) Query 5 ETVSLQELQQEVQQLQSLDHPCIVKLLGVSLLSSSCCCS 43 E S++ + +E+Q L+ LDHP I+KL G L++S CS Sbjct 171 EPESVRFMAREIQILRRLDHPNIIKLEG--LVTSRMSCS 207 > CE24774 Length=902 Score = 34.3 bits (77), Expect = 0.063, Method: Compositional matrix adjust. Identities = 11/29 (37%), Positives = 22/29 (75%), Gaps = 0/29 (0%) Query 11 ELQQEVQQLQSLDHPCIVKLLGVSLLSSS 39 +L+QE++ + + DHP ++KL+GV + +S Sbjct 611 QLEQEIRAVATFDHPNVIKLIGVCYMDNS 639 > Hs14770402 Length=926 Score = 33.5 bits (75), Expect = 0.11, Method: Compositional matrix adjust. Identities = 13/29 (44%), Positives = 22/29 (75%), Gaps = 0/29 (0%) Query 5 ETVSLQELQQEVQQLQSLDHPCIVKLLGV 33 + V+L+++ +EVQ ++ LDHP I+KL V Sbjct 57 DAVNLEKIYREVQIMKMLDHPHIIKLYQV 85 > 7292540 Length=4680 Score = 33.5 bits (75), Expect = 0.13, Method: Composition-based stats. Identities = 27/87 (31%), Positives = 36/87 (41%), Gaps = 9/87 (10%) Query 54 PCCSNLYPCPSTPPYCTCRSCANCCRTH--------AAAAATATAAAAAAAATEAAAGRL 105 P N P P+TP Y SC C R+ A A T ++ AT + Sbjct 4582 PVYLNSTPTPATPFYWMKISCTQCWRSSGQHCGWEAAFVAITCMPPLRSSGATRPWFWWM 4641 Query 106 RISACLSCLCCCGVQAVPTAAAAAASN 132 R A LS C G++ P AA+AS+ Sbjct 4642 R-PAALSRTACYGLEFPPPRCAASASS 4667 > At1g09000 Length=666 Score = 33.1 bits (74), Expect = 0.16, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 22/30 (73%), Gaps = 0/30 (0%) Query 3 EEETVSLQELQQEVQQLQSLDHPCIVKLLG 32 E+ +QEL++EV+ L++L HP IV+ LG Sbjct 110 EKTQAHIQELEEEVKLLKNLSHPNIVRYLG 139 > At5g11410 Length=336 Score = 32.7 bits (73), Expect = 0.18, Method: Compositional matrix adjust. Identities = 12/30 (40%), Positives = 22/30 (73%), Gaps = 0/30 (0%) Query 3 EEETVSLQELQQEVQQLQSLDHPCIVKLLG 32 ++ + +LQ+ ++EV+ L + HP +VKLLG Sbjct 92 QDNSQTLQDWKEEVKSLGRISHPNLVKLLG 121 > At2g43830 Length=250 Score = 32.7 bits (73), Expect = 0.19, Method: Compositional matrix adjust. Identities = 16/32 (50%), Positives = 22/32 (68%), Gaps = 0/32 (0%) Query 1 GAEEETVSLQELQQEVQQLQSLDHPCIVKLLG 32 GA+ ET L ++EVQ L++L HP IV+ LG Sbjct 126 GAKVETKVLVAREEEVQLLKNLSHPNIVRYLG 157 > Hs6382062 Length=1182 Score = 32.3 bits (72), Expect = 0.24, Method: Compositional matrix adjust. Identities = 11/31 (35%), Positives = 22/31 (70%), Gaps = 0/31 (0%) Query 3 EEETVSLQELQQEVQQLQSLDHPCIVKLLGV 33 +E+T+ ++E +E ++ + HP +V+LLGV Sbjct 320 KEDTMEVEEFLKEAAVMKEIKHPNLVQLLGV 350 > Hs6382060 Length=1146 Score = 32.3 bits (72), Expect = 0.26, Method: Compositional matrix adjust. Identities = 11/31 (35%), Positives = 22/31 (70%), Gaps = 0/31 (0%) Query 3 EEETVSLQELQQEVQQLQSLDHPCIVKLLGV 33 +E+T+ ++E +E ++ + HP +V+LLGV Sbjct 284 KEDTMEVEEFLKEAAVMKEIKHPNLVQLLGV 314 > At1g54960 Length=585 Score = 32.3 bits (72), Expect = 0.28, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 22/30 (73%), Gaps = 0/30 (0%) Query 3 EEETVSLQELQQEVQQLQSLDHPCIVKLLG 32 E+ +QEL++EV+ L++L HP IV+ LG Sbjct 109 EKTQAHIQELEEEVKLLKNLSHPNIVRYLG 138 > CE29341 Length=1030 Score = 32.0 bits (71), Expect = 0.34, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 0/31 (0%) Query 9 LQELQQEVQQLQSLDHPCIVKLLGVSLLSSS 39 + E +E + + DHP I+KL+GV+L SS Sbjct 774 ISEFYEEARTMSEFDHPNILKLIGVALDDSS 804 > At3g06030 Length=651 Score = 32.0 bits (71), Expect = 0.37, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 0/37 (0%) Query 3 EEETVSLQELQQEVQQLQSLDHPCIVKLLGVSLLSSS 39 E+ ++EL++EVQ L++L HP IV+ LG S S Sbjct 109 EKTQGHIRELEEEVQLLKNLSHPNIVRYLGTVRESDS 145 > At5g50000 Length=385 Score = 31.6 bits (70), Expect = 0.45, Method: Compositional matrix adjust. Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 7/59 (11%) Query 2 AEEETVSLQ-ELQQEVQQLQSLDHPCIVKLLGVSLLSSSCCC---SAPLPAAAKPQPCC 56 +E E VSL+ + QEV LDHP + K +G ++ +S S PL A P C Sbjct 120 SEAEIVSLRADFAQEVAVWHKLDHPNVTKFIGATMGASGLQLQTESGPL---AMPNNIC 175 > CE28667 Length=1086 Score = 31.6 bits (70), Expect = 0.45, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 0/31 (0%) Query 9 LQELQQEVQQLQSLDHPCIVKLLGVSLLSSS 39 + E +E + + DHP I+KL+GV+L SS Sbjct 774 ISEFYEEARTMSEFDHPNILKLIGVALDDSS 804 > SPBC337.04 Length=413 Score = 31.6 bits (70), Expect = 0.47, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 23/35 (65%), Gaps = 0/35 (0%) Query 4 EETVSLQELQQEVQQLQSLDHPCIVKLLGVSLLSS 38 E+ ++ +QE+ L++L HPC+V+LL + S+ Sbjct 144 EKKARVKVFRQEIWALKTLSHPCVVQLLNYYVSSA 178 > CE27768 Length=1096 Score = 30.4 bits (67), Expect = 1.1, Method: Composition-based stats. Identities = 15/26 (57%), Positives = 20/26 (76%), Gaps = 0/26 (0%) Query 8 SLQELQQEVQQLQSLDHPCIVKLLGV 33 SLQ+L +EV+ ++ LDHP IVKL V Sbjct 162 SLQKLFREVKIMKQLDHPNIVKLYQV 187 > CE23838 Length=1192 Score = 30.0 bits (66), Expect = 1.2, Method: Composition-based stats. Identities = 15/26 (57%), Positives = 20/26 (76%), Gaps = 0/26 (0%) Query 8 SLQELQQEVQQLQSLDHPCIVKLLGV 33 SLQ+L +EV+ ++ LDHP IVKL V Sbjct 210 SLQKLFREVKIMKQLDHPNIVKLYQV 235 > 7302464 Length=739 Score = 30.0 bits (66), Expect = 1.4, Method: Composition-based stats. Identities = 15/26 (57%), Positives = 20/26 (76%), Gaps = 0/26 (0%) Query 8 SLQELQQEVQQLQSLDHPCIVKLLGV 33 SLQ+L +EV+ ++ LDHP IVKL V Sbjct 191 SLQKLFREVRIMKMLDHPNIVKLFQV 216 > At5g66790 Length=622 Score = 28.5 bits (62), Expect = 3.5, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 8/41 (19%) Query 4 EETVSLQELQQEVQQLQSLDHPCIVKLLGVSLLSSSCCCSA 44 ++T S+ ++ E++ L S+ HP +V+LLG CC A Sbjct 347 KDTTSIDQVVNEIKLLSSVSHPNLVRLLG--------CCFA 379 Lambda K H 0.319 0.123 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1388795348 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40