bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_1193_orf2 Length=121 Score E Sequences producing significant alignments: (Bits) Value Hs8923930 39.7 0.001 At5g51720 38.1 0.004 Hs22044166 37.4 0.006 CE03767_1 34.7 0.049 7301766 34.3 0.062 Hs17435381 30.0 1.2 Hs4758908 27.3 8.0 > Hs8923930 Length=108 Score = 39.7 bits (91), Expect = 0.001, Method: Compositional matrix adjust. Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query 40 CRCWQSTKFPICDNPH-KVLQKQGCNCGPAMLE 71 CRCW+S KFP CD H K ++ G N GP +++ Sbjct 72 CRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIK 104 > At5g51720 Length=108 Score = 38.1 bits (87), Expect = 0.004, Method: Compositional matrix adjust. Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query 40 CRCWQSTKFPICDNPH-KVLQKQGCNCGPAMLE 71 CRCW+S FP+CD H K + G N GP +L+ Sbjct 74 CRCWRSGTFPLCDGSHVKHNKANGDNVGPLLLK 106 > Hs22044166 Length=547 Score = 37.4 bits (85), Expect = 0.006, Method: Compositional matrix adjust. Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 12/61 (19%) Query 14 MNVFNLPSVHQEIIYPTHKRTLNFSVCRCWQSTKFPICDNPH-KVLQKQGCNCGPAMLEV 72 ++ F++ + + +Y C CW+ KFP CD H K ++ G N GP ++E Sbjct 496 VHAFDMEDLEDKAVY-----------CHCWRYKKFPFCDGSHTKHNEQTGDNVGPLIIEK 544 Query 73 R 73 + Sbjct 545 K 545 > CE03767_1 Length=148 Score = 34.7 bits (78), Expect = 0.049, Method: Compositional matrix adjust. Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Query 38 SVCRCWQSTKFPICDNPHKVLQKQ-GCNCGPAMLE 71 + CRCW+S K+P CD H K+ G N GP +++ Sbjct 96 AFCRCWKSEKWPYCDGSHGKHNKETGDNVGPLIVK 130 > 7301766 Length=133 Score = 34.3 bits (77), Expect = 0.062, Method: Compositional matrix adjust. Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query 38 SVCRCWQSTKFPICDNPHKVLQKQ-GCNCGPAMLE 71 + CRCW++ +P CD H KQ G N GP +++ Sbjct 98 AFCRCWKTKNWPYCDGSHGEHNKQTGDNVGPIVIK 132 > Hs17435381 Length=141 Score = 30.0 bits (66), Expect = 1.2, Method: Compositional matrix adjust. Identities = 9/13 (69%), Positives = 11/13 (84%), Gaps = 0/13 (0%) Query 40 CRCWQSTKFPICD 52 C CW+S KFP+CD Sbjct 99 CHCWRSRKFPLCD 111 > Hs4758908 Length=621 Score = 27.3 bits (59), Expect = 8.0, Method: Compositional matrix adjust. Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 4/63 (6%) Query 58 LQKQGCNCGPAM-LEVRHAPSVTEPREFRSTSESSKDKLSTGSLFGGAASVAAAVA-AGG 115 L K GC+ PA+ +++R PR S+ S K S SL GG++ V +A AG Sbjct 44 LLKSGCS--PAVQIKIRELYRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGI 101 Query 116 HAL 118 H+L Sbjct 102 HSL 104 Lambda K H 0.320 0.133 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1198419392 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40