bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_1239_orf1 Length=75 Score E Sequences producing significant alignments: (Bits) Value Hs4505651 47.8 5e-06 7298016 38.9 0.002 At2g38670 37.4 0.007 CE26830 35.4 0.028 At2g03030 27.3 6.7 At4g31040 26.9 9.1 > Hs4505651 Length=389 Score = 47.8 bits (112), Expect = 5e-06, Method: Composition-based stats. Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 0/65 (0%) Query 10 DPYKVPKEMGIYREAESFSLWTTRELVSRVIQNRQTLSATIGNREKKETHFWESLSGQTA 69 DPY+ PK GI+R+ +S S TT +V R+I NR A +E KE F E+ Q A Sbjct 320 DPYQEPKRRGIFRQIDSGSNLTTDLIVQRIITNRLEYEARNQKKEAKELAFLEAARQQAA 379 Query 70 RLIAE 74 + + E Sbjct 380 QPLGE 384 > 7298016 Length=363 Score = 38.9 bits (89), Expect = 0.002, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 0/58 (0%) Query 10 DPYKVPKEMGIYREAESFSLWTTRELVSRVIQNRQTLSATIGNREKKETHFWESLSGQ 67 DPY VPK I+ +S + TT +V R+I +R +EKKE +E+L Q Sbjct 299 DPYAVPKTRAIFELIDSGNEMTTERIVERIISHRLEYERRNQAKEKKEIEAFEALQRQ 356 > At2g38670 Length=421 Score = 37.4 bits (85), Expect = 0.007, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 0/59 (0%) Query 7 QQEDPYKVPKEMGIYREAESFSLWTTRELVSRVIQNRQTLSATIGNREKKETHFWESLS 65 ++++PY VP MGI++ +S TT ++ R++ N + +E E ++E S Sbjct 358 EEDNPYSVPISMGIFQVLDSPLDITTSTIIRRIVANHEAYQKRNAKKEASEKKYYEQKS 416 > CE26830 Length=370 Score = 35.4 bits (80), Expect = 0.028, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 0/48 (0%) Query 10 DPYKVPKEMGIYREAESFSLWTTRELVSRVIQNRQTLSATIGNREKKE 57 DP+ K GIY E +S S TT ++ R+I +R +EKKE Sbjct 313 DPFAEAKRRGIYHEVDSGSDMTTDLIIDRIIHHRLEYETRNKKKEKKE 360 > At2g03030 Length=204 Score = 27.3 bits (59), Expect = 6.7, Method: Compositional matrix adjust. Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 4/47 (8%) Query 14 VPKEMGIYREAESFSLWTTRELVSRVIQNRQTLSATIGNREKKETHF 60 +P +MG+ +S + + + V++ Q + ATIG E++E HF Sbjct 139 IPNKMGLSLGDKS----SEADFIKEVVKAVQCVVATIGLEEEEENHF 181 > At4g31040 Length=293 Score = 26.9 bits (58), Expect = 9.1, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Query 7 QQEDPYKVPKEMGIYREAESFSLW-TTRELVSRVIQNRQTLSATIGNREKKETHFWE 62 Q DP + Y+ +S SLW R+ + R + + + ++ GN K+ +W+ Sbjct 12 QNPDPESSSSSLLRYKPCDSISLWGKRRKKLWRFVPSAEKNNSHTGNNNKRRRSWWQ 68 Lambda K H 0.313 0.130 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1181410888 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40