bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_1480_orf1 Length=95 Score E Sequences producing significant alignments: (Bits) Value YKL059c 41.2 4e-04 Hs22068920 35.0 0.033 SPBP8B7.15c 33.1 0.12 At5g47430 32.7 0.16 7291741_1 31.2 0.48 7302219 28.5 3.2 7294710 28.1 4.0 CE13519 26.9 7.9 At4g17410 26.9 9.3 > YKL059c Length=441 Score = 41.2 bits (95), Expect = 4e-04, Method: Composition-based stats. Identities = 23/61 (37%), Positives = 34/61 (55%), Gaps = 9/61 (14%) Query 3 HHIKNCPKSSDAK-QQKKIRPATGLPSSFLRDI-------LPSEIHKYQEVYIKKDGSFA 54 H IKNCP +SD + K+IR TG+P FL+ I P E+ + +++ I +G F Sbjct 190 HWIKNCPTNSDPNFEGKRIRRTTGIPKKFLKSIEIDPETMTPEEMAQ-RKIMITDEGKFV 248 Query 55 V 55 V Sbjct 249 V 249 > Hs22068920 Length=1663 Score = 35.0 bits (79), Expect = 0.033, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 24/35 (68%), Gaps = 2/35 (5%) Query 2 GHHIKNCPKSSDAKQQK--KIRPATGLPSSFLRDI 34 GH+IKNCP + D + +I+ +TG+P SF+ ++ Sbjct 73 GHYIKNCPTNGDKNFESGPRIKKSTGIPRSFMMEV 107 > SPBP8B7.15c Length=482 Score = 33.1 bits (74), Expect = 0.12, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Query 2 GHHIKNCPKSSDAKQQKK--IRPATGLPSSFLRDILPSEIHKYQEVYIKKDGSFAVLK 57 GH I+ CP ++D K ++ TG+P SFL+++ + I +G + V++ Sbjct 192 GHWIQACPTNADPNYDGKPRVKRTTGIPRSFLKNVERPAEGDAANIMINAEGDYVVVQ 249 > At5g47430 Length=879 Score = 32.7 bits (73), Expect = 0.16, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query 2 GHHIKNCPKSSDAKQQ-KKIRPATGLPSSFL 31 GH I++CP + D K+++P TG+P S L Sbjct 217 GHFIQHCPTNGDPNYDVKRVKPPTGIPKSML 247 > 7291741_1 Length=286 Score = 31.2 bits (69), Expect = 0.48, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Query 2 GHHIKNCPKSSDAKQQKKIRPATGLPSSF 30 GH IKNCP K Q++++ TG+P SF Sbjct 160 GHWIKNCPFVG-GKDQQEVKRNTGIPRSF 187 > 7302219 Length=469 Score = 28.5 bits (62), Expect = 3.2, Method: Compositional matrix adjust. Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 0/40 (0%) Query 13 DAKQQKKIRPATGLPSSFLRDILPSEIHKYQEVYIKKDGS 52 DAK K++ TGLP L+ + K++ + +K+DGS Sbjct 393 DAKDLKQLSQKTGLPKRVLQVWFQNARAKWRRMMMKQDGS 432 > 7294710 Length=537 Score = 28.1 bits (61), Expect = 4.0, Method: Compositional matrix adjust. Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 10/54 (18%) Query 15 KQQKKIRPATGLPSSFLRDILPSEIHK----------YQEVYIKKDGSFAVLKT 58 K+ +K + PSS +RD+L SE+ K Y+E+Y KK V KT Sbjct 56 KKSQKFPAGSVQPSSSIRDLLTSELQKSRFMSFKEKFYEEMYFKKATLGGVKKT 109 > CE13519 Length=351 Score = 26.9 bits (58), Expect = 7.9, Method: Composition-based stats. Identities = 21/48 (43%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Query 5 IKNCPKSSDAKQQKKIRPATGLPSSFLRDILPSEIHKYQEVYIKKDGS 52 IKN +SDAK K RP + S L P EI KY+EV +K++ S Sbjct 114 IKN--GTSDAKSHLK-RPFVPI-SPILPHRAPQEIQKYEEVSVKEEPS 157 > At4g17410 Length=744 Score = 26.9 bits (58), Expect = 9.3, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query 2 GHHIKNCPKSSDAK-QQKKIRPATGLPSSFL 31 GH I++C + + K+++P TG+P S L Sbjct 128 GHFIQHCSTNGNPNFDVKRVKPPTGIPKSML 158 Lambda K H 0.321 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1161385214 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40