bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_1514_orf1 Length=152 Score E Sequences producing significant alignments: (Bits) Value SPCC1442.14c 38.9 0.004 7295909 33.5 0.16 Hs4503719 31.6 0.56 YDL125c 31.2 0.80 7297165 27.7 9.8 > SPCC1442.14c Length=133 Score = 38.9 bits (89), Expect = 0.004, Method: Compositional matrix adjust. Identities = 23/72 (31%), Positives = 38/72 (52%), Gaps = 4/72 (5%) Query 5 VAILDAFPTAPGHSLLISKAPVETVMELSEQQAADVLKELPRLCRAV----QQVCIHTQR 60 +A LD PT+ GH+L+I K + ELS++ AD+L + ++ +A+ V + R Sbjct 25 LAFLDIAPTSKGHALVIPKEHAAKMHELSDESCADILPLVKKVTKAIGPENYNVLQNNGR 84 Query 61 QQYAFVSTAHPH 72 + FV H H Sbjct 85 IAHQFVDHVHFH 96 > 7295909 Length=126 Score = 33.5 bits (75), Expect = 0.16, Method: Compositional matrix adjust. Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Query 2 EHCVAILDAFPTAPGHSLLISKAPVETVMELSEQQAADVLKELPRLCRAVQQ 53 + CVA D P AP H L+I + P+ + L+E AD+L L + R V + Sbjct 36 DKCVAFHDVAPQAPTHFLVIPRKPIAQ-LSLAEDGDADLLGHLMLVGRKVAK 86 > Hs4503719 Length=147 Score = 31.6 bits (70), Expect = 0.56, Method: Compositional matrix adjust. Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 0/53 (0%) Query 1 TEHCVAILDAFPTAPGHSLLISKAPVETVMELSEQQAADVLKELPRLCRAVQQ 53 TE A+++ P PGH L+ PVE +L + AD+ + R+ V++ Sbjct 19 TELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEK 71 > YDL125c Length=158 Score = 31.2 bits (69), Expect = 0.80, Method: Compositional matrix adjust. Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 0/52 (0%) Query 1 TEHCVAILDAFPTAPGHSLLISKAPVETVMELSEQQAADVLKELPRLCRAVQ 52 T++ A LD PTA GH+L+I K + ++ ++ D + RL +A++ Sbjct 43 TKYSYAFLDIQPTAEGHALIIPKYHGAKLHDIPDEFLTDAMPIAKRLAKAMK 94 > 7297165 Length=992 Score = 27.7 bits (60), Expect = 9.8, Method: Compositional matrix adjust. Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 0/25 (0%) Query 94 SGNKLRRRERPPQRRRGCGPNCSSS 118 SG +++ PP+R+R CGP SS+ Sbjct 799 SGEQVQSTALPPKRQRSCGPRLSST 823 Lambda K H 0.327 0.135 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1925034518 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40