bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_1784_orf1 Length=158 Score E Sequences producing significant alignments: (Bits) Value Hs20070218 40.0 0.002 7292125 38.9 0.005 At2g19270 37.4 0.012 CE20559 34.7 0.070 Hs14589909 29.6 2.7 Hs22042035 28.9 4.6 At2g21250 28.5 5.3 > Hs20070218 Length=491 Score = 40.0 bits (92), Expect = 0.002, Method: Compositional matrix adjust. Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 0/46 (0%) Query 113 EPKVMQKRKHQINWLAAEAHDKELEMLEMTARTRQSKYQTAMKYGW 158 +P Q+RKHQI +L +A ++ELE+ + + S+ QT KYG+ Sbjct 446 QPTGQQRRKHQITYLIHQAKERELELKNTWSENKLSRRQTQAKYGF 491 > 7292125 Length=472 Score = 38.9 bits (89), Expect = 0.005, Method: Compositional matrix adjust. Identities = 24/63 (38%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Query 96 LATKVWNAEEGVVTETLEPKVMQKRKHQINWLAAEAHDKELEMLEMTARTRQSKYQTAMK 155 LA+ GV+T+ EP +RKHQI +LA +A E E+ M + RQ++ T K Sbjct 411 LASSTTFQPTGVLTDE-EPVAGTRRKHQITYLAHKAKANEAELQAMWSANRQTRRATQSK 469 Query 156 YGW 158 YG+ Sbjct 470 YGF 472 > At2g19270 Length=359 Score = 37.4 bits (85), Expect = 0.012, Method: Compositional matrix adjust. Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Query 108 VTETLEPKV--MQKRKHQINWLAAEAHDKELEMLEMTARTRQSKYQTAMKYGW 158 VT + + KV + KRKHQI L + KE E+ E +R +K +T KYGW Sbjct 307 VTSSSKGKVSKLHKRKHQITALFMDMKHKESELTERRSRGLLTKAETQAKYGW 359 > CE20559 Length=405 Score = 34.7 bits (78), Expect = 0.070, Method: Compositional matrix adjust. Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 0/42 (0%) Query 117 MQKRKHQINWLAAEAHDKELEMLEMTARTRQSKYQTAMKYGW 158 M +RKHQI +LA+ A +E ++ + A +QSK KYG+ Sbjct 364 MSRRKHQITYLASLAVSREEQLKDQWADQKQSKRMARQKYGF 405 > Hs14589909 Length=846 Score = 29.6 bits (65), Expect = 2.7, Method: Composition-based stats. Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 11/81 (13%) Query 4 DYGAAEAADYGAAANEAAAAAATAA--GAAWTLKEEEAAIEELGIEKTIISGISQAELRD 61 D+G + AD+G AA A A + G + + E AA+E+ G G +Q L D Sbjct 150 DHGDVKLADFGVAAKITATIAKRKSFIGTPYWMAPEVAAVEKNG-------GYNQ--LCD 200 Query 62 LRRMGATSVSGATLQNPDWQL 82 + +G T++ LQ P + L Sbjct 201 IWAVGITAIELGELQPPMFDL 221 > Hs22042035 Length=1407 Score = 28.9 bits (63), Expect = 4.6, Method: Composition-based stats. Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 4/43 (9%) Query 75 LQNPDWQLTSQTGPQKKGKLRLATKVWNAEEGVVTETLEPKVM 117 L P W T +GP L + K WN + V LEPKV+ Sbjct 1316 LNTPRWTSTQTSGP----GLPIGFKGWNGQIFKVNTLLEPKVL 1354 > At2g21250 Length=309 Score = 28.5 bits (62), Expect = 5.3, Method: Compositional matrix adjust. Identities = 14/43 (32%), Positives = 26/43 (60%), Gaps = 3/43 (6%) Query 85 QTGPQKKGKLRLATKVWNAEEGVVTETLEPKVMQKRKHQINWL 127 +TG K+ L + TK+WN++ G V E + + +K Q+++L Sbjct 62 KTGLVKREDLFITTKLWNSDHGHVIEACKDSL---KKLQLDYL 101 Lambda K H 0.308 0.120 0.339 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2100092188 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40