bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_1788_orf1 Length=99 Score E Sequences producing significant alignments: (Bits) Value 7303893 38.9 0.003 SPAC644.11c 38.5 0.003 YIL042c 32.0 0.31 CE00397 31.6 0.36 Hs19923736 31.6 0.39 > 7303893 Length=413 Score = 38.9 bits (89), Expect = 0.003, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Query 44 SSTMPPVDIHLISAADSGVVIKVSDSGGGLCRTEQQLAWQFLYSTRTAPTDKD 96 + T+PP+ + + + + +K+SD GGG+ R++ ++++YST P+ D Sbjct 271 NDTLPPLKVAICKGKED-ICVKISDQGGGIPRSQTDQLFKYMYSTAPQPSKSD 322 > SPAC644.11c Length=425 Score = 38.5 bits (88), Expect = 0.003, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Query 44 SSTMPPVDIHLISAADSGVVIKVSDSGGGLCRTEQQLAWQFLYSTRTAPTDKD 96 S PP+ + +++ + IK+SD GGG+ R L W ++++T +PT D Sbjct 313 SDFFPPIKV-IVAKGQEDITIKISDEGGGISRRNIPLVWSYMFTT-ASPTLTD 363 > YIL042c Length=394 Score = 32.0 bits (71), Expect = 0.31, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 25/42 (59%), Gaps = 0/42 (0%) Query 49 PVDIHLISAADSGVVIKVSDSGGGLCRTEQQLAWQFLYSTRT 90 P++I+L+ D + +++ D GGG+ + L + + YST T Sbjct 285 PIEINLLKPDDDELYLRIRDHGGGITPEVEALMFNYSYSTHT 326 > CE00397 Length=401 Score = 31.6 bits (70), Expect = 0.36, Method: Compositional matrix adjust. Identities = 15/51 (29%), Positives = 30/51 (58%), Gaps = 2/51 (3%) Query 47 MPPVDIHLISAADSGVVIKVSDSGGGLCRTEQQLAWQFLYSTRTAPTDKDG 97 +P + ++++ + + IK+ D GGG+ RT + + ++YST P +DG Sbjct 266 LPDIKVYVVKGQED-LSIKICDRGGGVSRTILERLYNYMYST-APPPPRDG 314 > Hs19923736 Length=407 Score = 31.6 bits (70), Expect = 0.39, Method: Compositional matrix adjust. Identities = 17/55 (30%), Positives = 34/55 (61%), Gaps = 3/55 (5%) Query 43 TSSTMPPVDIHLISAADSGVVIKVSDSGGGLCRTEQQLAWQFLYSTRTAPTDKDG 97 +S +PP+ + +++ + + IK+SD GGG+ + + + ++YS TAPT + G Sbjct 266 SSLILPPIKV-MVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYS--TAPTPQPG 317 Lambda K H 0.312 0.127 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1191270180 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40