bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_2237_orf1 Length=77 Score E Sequences producing significant alignments: (Bits) Value SPBC530.01 96.7 9e-21 7300700 83.6 8e-17 Hs8923314 83.6 9e-17 YOR070c 82.4 2e-16 Hs18594431 80.9 6e-16 At2g30710 79.0 2e-15 CE09863 77.4 5e-15 ECU04g1530 31.2 0.44 CE11492 28.1 4.3 Hs11225266 27.7 5.3 At4g13730 27.3 7.7 At3g42170 26.9 8.2 > SPBC530.01 Length=514 Score = 96.7 bits (239), Expect = 9e-21, Method: Composition-based stats. Identities = 39/74 (52%), Positives = 57/74 (77%), Gaps = 0/74 (0%) Query 3 YLCEQAEGFSDFHVYVCAVFLVNWSRQLKQMDFQQMIMFIQNFPTTTWGSQEIETLLAEA 62 Y+ E +GFS+FH+YVCA FLV WS +L++M+FQ +++F+Q+ PT W +++IE LL+EA Sbjct 439 YMAEGVQGFSEFHLYVCAAFLVKWSSELQKMEFQDILIFLQSIPTKDWSTKDIEILLSEA 498 Query 63 FVLKSLYHSAPKHL 76 F+ KSLY A HL Sbjct 499 FLWKSLYSGAGAHL 512 > 7300700 Length=545 Score = 83.6 bits (205), Expect = 8e-17, Method: Compositional matrix adjust. Identities = 40/75 (53%), Positives = 53/75 (70%), Gaps = 2/75 (2%) Query 3 YLCEQAEGFSDFHVYVCAVFLVNWSRQL-KQMDFQQMIMFIQNFPTTTWGSQEIETLLAE 61 YL E ++GF+ FH+YVCA FL++W QL +Q DFQ +++ +QN PT W ++I LLAE Sbjct 468 YLAE-SDGFALFHLYVCAAFLLHWKEQLMQQNDFQGLMLLLQNLPTHNWSDRQINVLLAE 526 Query 62 AFVLKSLYHSAPKHL 76 AF LK Y APKHL Sbjct 527 AFRLKFTYADAPKHL 541 > Hs8923314 Length=163 Score = 83.6 bits (205), Expect = 9e-17, Method: Compositional matrix adjust. Identities = 36/70 (51%), Positives = 50/70 (71%), Gaps = 1/70 (1%) Query 7 QAEGFSDFHVYVCAVFLVNWSRQ-LKQMDFQQMIMFIQNFPTTTWGSQEIETLLAEAFVL 65 + EGFS FH+YVCA FL+ W ++ L + DFQ ++M +QN PT WG++EI LLAEA+ L Sbjct 91 EPEGFSHFHLYVCAAFLIKWRKEILDEEDFQGLLMLLQNLPTIHWGNEEIGLLLAEAYRL 150 Query 66 KSLYHSAPKH 75 K ++ AP H Sbjct 151 KYMFADAPNH 160 > YOR070c Length=637 Score = 82.4 bits (202), Expect = 2e-16, Method: Composition-based stats. Identities = 35/65 (53%), Positives = 46/65 (70%), Gaps = 0/65 (0%) Query 11 FSDFHVYVCAVFLVNWSRQLKQMDFQQMIMFIQNFPTTTWGSQEIETLLAEAFVLKSLYH 70 ++FHV+VCA FL+ WS QL +MDFQ+ I F+QN PT W +IE LL+EAF+ +SLY Sbjct 571 LNEFHVFVCAAFLIKWSDQLMEMDFQETITFLQNPPTKDWTETDIEMLLSEAFIWQSLYK 630 Query 71 SAPKH 75 A H Sbjct 631 DATSH 635 > Hs18594431 Length=517 Score = 80.9 bits (198), Expect = 6e-16, Method: Compositional matrix adjust. Identities = 34/70 (48%), Positives = 50/70 (71%), Gaps = 1/70 (1%) Query 7 QAEGFSDFHVYVCAVFLVNWSRQ-LKQMDFQQMIMFIQNFPTTTWGSQEIETLLAEAFVL 65 + +GFS FH+YVCA FLV W ++ L++ DFQ++++F+QN PT W ++I LLAEA+ L Sbjct 445 EPDGFSHFHLYVCAAFLVRWRKEILEEKDFQELLLFLQNLPTAHWDDEDISLLLAEAYRL 504 Query 66 KSLYHSAPKH 75 K + AP H Sbjct 505 KFAFADAPNH 514 > At2g30710 Length=343 Score = 79.0 bits (193), Expect = 2e-15, Method: Composition-based stats. Identities = 33/74 (44%), Positives = 53/74 (71%), Gaps = 1/74 (1%) Query 3 YLCEQAEGFSDFHVYVCAVFLVNWSRQLKQMDFQQMIMFIQNFPTTTWGSQEIETLLAEA 62 YL E + DF VY+ A FL+ WS +LK++DFQ+M+MF+Q+ PT W QE+E +L+ A Sbjct 269 YLAE-GDALPDFLVYIYASFLLTWSDELKKLDFQEMVMFLQHLPTHNWSDQELEMVLSRA 327 Query 63 FVLKSLYHSAPKHL 76 ++ S+++++P HL Sbjct 328 YMWHSMFNNSPNHL 341 > CE09863 Length=495 Score = 77.4 bits (189), Expect = 5e-15, Method: Composition-based stats. Identities = 37/76 (48%), Positives = 53/76 (69%), Gaps = 2/76 (2%) Query 3 YLCEQAEGFSDFHVYVCAVFLVNWSRQLK-QMDFQQMIMFIQNFPTTTWGSQEIETLLAE 61 YL E +GF FH YVCA FL WS+QL+ + DFQ +++ +QN PT +WG +EI L A+ Sbjct 415 YLSE-PDGFMQFHNYVCAAFLRTWSKQLQAEKDFQGVMILLQNLPTQSWGDREICELTAD 473 Query 62 AFVLKSLYHSAPKHLN 77 AF L+S++ A +HL+ Sbjct 474 AFSLQSVFDGARRHLS 489 > ECU04g1530 Length=329 Score = 31.2 bits (69), Expect = 0.44, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 0/47 (0%) Query 16 VYVCAVFLVNWSRQLKQMDFQQMIMFIQNFPTTTWGSQEIETLLAEA 62 VY L+ + L + DF I+F+Q+ W EIE +L+ A Sbjct 265 VYFGVALLMKFKSTLVENDFSHNILFLQSIYDREWEEAEIELILSSA 311 > CE11492 Length=430 Score = 28.1 bits (61), Expect = 4.3, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query 24 VNWSRQLK-QMDFQQMIMFIQNFPTTTWGSQE 54 ++W+R ++ +M+ QQ+I+ I N W S + Sbjct 221 ISWARSIRRKMNSQQLILIIDNIEAPDWRSDQ 252 > Hs11225266 Length=1165 Score = 27.7 bits (60), Expect = 5.3, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Query 23 LVNWSRQLKQMDFQQMIMFIQNFPTTTWGSQEIETLLAEAFVLKSLYHS 71 +V W++ L+ + Q ++ + +F GS+E++T++ +A V HS Sbjct 296 IVRWTKLLQNITSHQHLLTVYDFEQE--GSEELDTVILKALVKACKSHS 342 > At4g13730 Length=449 Score = 27.3 bits (59), Expect = 7.7, Method: Composition-based stats. Identities = 13/45 (28%), Positives = 21/45 (46%), Gaps = 0/45 (0%) Query 4 LCEQAEGFSDFHVYVCAVFLVNWSRQLKQMDFQQMIMFIQNFPTT 48 L EG + + +C L+ R+L DF + +QN+P T Sbjct 390 LLSDPEGPQETLLRICCAMLILVRRRLLAGDFTSNLKLLQNYPPT 434 > At3g42170 Length=696 Score = 26.9 bits (58), Expect = 8.2, Method: Compositional matrix adjust. Identities = 13/47 (27%), Positives = 21/47 (44%), Gaps = 0/47 (0%) Query 7 QAEGFSDFHVYVCAVFLVNWSRQLKQMDFQQMIMFIQNFPTTTWGSQ 53 +A+G SDF Y+ N +L Q + ++ +Q F W Q Sbjct 570 KADGLSDFDTYIMETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQ 616 Lambda K H 0.326 0.134 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1175087368 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40