bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_2384_orf1 Length=125 Score E Sequences producing significant alignments: (Bits) Value 7295083 33.9 0.075 CE05155 33.1 0.14 At1g16650 32.3 0.20 SPBC1A4.09 32.0 0.27 YOR243c 31.6 0.39 SPAC17G6.08 30.4 0.92 > 7295083 Length=734 Score = 33.9 bits (76), Expect = 0.075, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 20/26 (76%), Gaps = 0/26 (0%) Query 66 RDFIEERMHAVSSLGFLNYFGLQRFG 91 R+ IE+ + ++ GF+NY+GLQRFG Sbjct 337 REEIEQALQSLKERGFINYYGLQRFG 362 > CE05155 Length=577 Score = 33.1 bits (74), Expect = 0.14, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 0/35 (0%) Query 68 FIEERMHAVSSLGFLNYFGLQRFGAKKQRQQQLVL 102 + +R+ + GF+NYFG QRFG++ ++ L Sbjct 253 LLHQRLETFQNTGFINYFGTQRFGSRSSTTAEIGL 287 > At1g16650 Length=529 Score = 32.3 bits (72), Expect = 0.20, Method: Compositional matrix adjust. Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 1/62 (1%) Query 20 EEASSSSSSTASNNNSSSSSSTDSSSSSSRRGCGVHALEVAEVSALRDFIE-ERMHAVSS 78 +E SS S+ S S SS+D++ S S G+HA V+ LR F+E E + A+ S Sbjct 241 DETDSSGSALNEEGQSRSQSSSDANRSCSLVLAGLHACGDLSVTMLRTFMECEEVKALVS 300 Query 79 LG 80 +G Sbjct 301 IG 302 > SPBC1A4.09 Length=680 Score = 32.0 bits (71), Expect = 0.27, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 0/33 (0%) Query 59 VAEVSALRDFIEERMHAVSSLGFLNYFGLQRFG 91 V V ++ + E ++++ GF+NYFGLQRFG Sbjct 337 VRNVITPKEKVVEALNSLKEHGFINYFGLQRFG 369 > YOR243c Length=676 Score = 31.6 bits (70), Expect = 0.39, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Query 60 AEVSALRDFIEERMHAVSSLGFLNYFGLQRFG 91 +EVS L + + ++S GF+NYFG+QRFG Sbjct 319 SEVS-LEEIVSNGCKSLSENGFINYFGMQRFG 349 > SPAC17G6.08 Length=536 Score = 30.4 bits (67), Expect = 0.92, Method: Compositional matrix adjust. Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 0/47 (0%) Query 24 SSSSSTASNNNSSSSSSTDSSSSSSRRGCGVHALEVAEVSALRDFIE 70 SS+ S S N S+S+ +DSS+ C + LE+ +SAL D ++ Sbjct 13 SSNLSNHSGTNLSTSAQSDSSNIVKATECPICGLELPNLSALNDHLD 59 Lambda K H 0.315 0.122 0.340 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1183965632 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40