bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_3021_orf1 Length=119 Score E Sequences producing significant alignments: (Bits) Value Hs4502227 35.0 0.034 Hs4507449 32.0 0.27 YBR164c 32.0 0.28 At2g18390 31.2 0.45 7291007 30.8 0.69 7302475 30.4 0.82 Hs18582440 30.0 0.98 7295126 29.6 1.4 Hs4502197_2 29.6 1.5 CE02250 29.6 1.5 YPL051w 29.6 1.5 CE15872 29.3 1.7 7291181 29.3 1.8 SPAC22F3.05c 29.3 1.8 At1g10180 28.9 2.3 SPCC576.08c 28.9 2.3 At5g17880 28.9 2.6 Hs4757774 28.9 2.7 Hs18587779 28.5 3.3 YDL137w 28.5 3.4 Hs19923609 28.1 3.7 CE11156 28.1 4.6 7300792 27.7 5.0 Hs4502201 27.7 5.1 Hs22049577 27.7 5.1 Hs4502203 27.7 5.2 7292144 27.3 7.2 Hs22041463 27.3 7.6 CE27954 27.3 7.7 Hs13376488 27.3 7.7 Hs4507675 26.9 7.9 CE00696 26.9 8.0 Hs6912244 26.9 8.3 7296589 26.9 9.9 > Hs4502227 Length=181 Score = 35.0 bits (79), Expect = 0.034, Method: Compositional matrix adjust. Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 4/43 (9%) Query 57 SCSLCSSLSLPAFSG----VFACSAKTGEGIEEGISWLIRQLK 95 S + +SL LPA +F SA G G++E + WL+ LK Sbjct 136 SSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLK 178 > Hs4507449 Length=201 Score = 32.0 bits (71), Expect = 0.27, Method: Compositional matrix adjust. Identities = 11/19 (57%), Positives = 16/19 (84%), Gaps = 0/19 (0%) Query 74 ACSAKTGEGIEEGISWLIR 92 ACSA TG+G+ EGI W+++ Sbjct 167 ACSALTGKGVREGIEWMVK 185 > YBR164c Length=183 Score = 32.0 bits (71), Expect = 0.28, Method: Compositional matrix adjust. Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 0/26 (0%) Query 72 VFACSAKTGEGIEEGISWLIRQLKQQ 97 + A SA GEGI EG+ WLI +K++ Sbjct 156 IVASSAIKGEGITEGLDWLIDVIKEE 181 > At2g18390 Length=185 Score = 31.2 bits (69), Expect = 0.45, Method: Compositional matrix adjust. Identities = 11/23 (47%), Positives = 16/23 (69%), Gaps = 0/23 (0%) Query 72 VFACSAKTGEGIEEGISWLIRQL 94 + CSA TGEG+ EG WL++ + Sbjct 155 IVGCSAYTGEGLLEGFDWLVQDI 177 > 7291007 Length=196 Score = 30.8 bits (68), Expect = 0.69, Method: Compositional matrix adjust. Identities = 11/23 (47%), Positives = 16/23 (69%), Gaps = 0/23 (0%) Query 75 CSAKTGEGIEEGISWLIRQLKQQ 97 SA GEG++EGI WL+ +K+ Sbjct 164 VSALHGEGVDEGIKWLVEAIKRH 186 > 7302475 Length=202 Score = 30.4 bits (67), Expect = 0.82, Method: Compositional matrix adjust. Identities = 11/22 (50%), Positives = 18/22 (81%), Gaps = 0/22 (0%) Query 74 ACSAKTGEGIEEGISWLIRQLK 95 + SA +GEG+ EG+ WLI+Q++ Sbjct 163 SSSAISGEGLGEGVQWLIQQMR 184 > Hs18582440 Length=222 Score = 30.0 bits (66), Expect = 0.98, Method: Compositional matrix adjust. Identities = 15/51 (29%), Positives = 31/51 (60%), Gaps = 0/51 (0%) Query 15 SGNTTSVTVASACGQGMVRLSPPPKRETLHVKYYFPSARIRLSCSLCSSLS 65 +G + +TVAS C QG+V++S +RE + + R+R + ++ ++L+ Sbjct 116 AGGASGITVASCCAQGVVKVSSQERREGTLALHTARNPRLRSAATVQATLA 166 > 7295126 Length=179 Score = 29.6 bits (65), Expect = 1.4, Method: Compositional matrix adjust. Identities = 10/24 (41%), Positives = 19/24 (79%), Gaps = 0/24 (0%) Query 74 ACSAKTGEGIEEGISWLIRQLKQQ 97 AC A TGEG+ +G+ W+++++K + Sbjct 156 ACCALTGEGLYQGLEWIVQRIKNK 179 > Hs4502197_2 Length=173 Score = 29.6 bits (65), Expect = 1.5, Method: Compositional matrix adjust. Identities = 11/20 (55%), Positives = 15/20 (75%), Gaps = 0/20 (0%) Query 75 CSAKTGEGIEEGISWLIRQL 94 C A++G G+ EG+ WL RQL Sbjct 145 CDARSGMGLYEGLDWLSRQL 164 > CE02250 Length=180 Score = 29.6 bits (65), Expect = 1.5, Method: Compositional matrix adjust. Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 0/26 (0%) Query 72 VFACSAKTGEGIEEGISWLIRQLKQQ 97 +F SA GEG++ + WL QL+Q+ Sbjct 154 IFKTSASKGEGLDPAMDWLANQLQQK 179 > YPL051w Length=198 Score = 29.6 bits (65), Expect = 1.5, Method: Compositional matrix adjust. Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 0/28 (0%) Query 70 SGVFACSAKTGEGIEEGISWLIRQLKQQ 97 S V SA TGEG+++ I W+I +L++ Sbjct 162 SRVLPISALTGEGVKDAIEWMIVRLERN 189 > CE15872 Length=184 Score = 29.3 bits (64), Expect = 1.7, Method: Compositional matrix adjust. Identities = 12/22 (54%), Positives = 15/22 (68%), Gaps = 0/22 (0%) Query 74 ACSAKTGEGIEEGISWLIRQLK 95 ACSA EGI +GI+W+ LK Sbjct 158 ACSALKNEGINDGITWVASNLK 179 > 7291181 Length=930 Score = 29.3 bits (64), Expect = 1.8, Method: Compositional matrix adjust. Identities = 18/48 (37%), Positives = 21/48 (43%), Gaps = 0/48 (0%) Query 6 AGQAGCSIGSGNTTSVTVASACGQGMVRLSPPPKRETLHVKYYFPSAR 53 AG GSGN T+ A+A G G+ LS K T Y F R Sbjct 20 AGSTANGTGSGNGTATGNATAAGSGLGPLSLHTKSSTFDYLYEFSETR 67 > SPAC22F3.05c Length=186 Score = 29.3 bits (64), Expect = 1.8, Method: Compositional matrix adjust. Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 0/25 (0%) Query 72 VFACSAKTGEGIEEGISWLIRQLKQ 96 +F+ SA TG I++ ISWL LK+ Sbjct 154 IFSVSALTGLNIKDAISWLANDLKE 178 > At1g10180 Length=769 Score = 28.9 bits (63), Expect = 2.3, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 0/38 (0%) Query 30 GMVRLSPPPKRETLHVKYYFPSARIRLSCSLCSSLSLP 67 G++RL P L +K+Y S R R+ L S L+ P Sbjct 206 GLIRLGKGPSAHQLLLKFYATSLRRRIEAFLPSCLTCP 243 > SPCC576.08c Length=253 Score = 28.9 bits (63), Expect = 2.3, Method: Compositional matrix adjust. Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 0/35 (0%) Query 5 KAGQAGCSIGSGNTTSVTVASACGQGMVRLSPPPK 39 + G G ++G +T V V+ CG VRL P P+ Sbjct 139 RRGYWGTALGDPHTVPVKVSGKCGSVTVRLVPAPR 173 > At5g17880 Length=1197 Score = 28.9 bits (63), Expect = 2.6, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 17/36 (47%), Gaps = 0/36 (0%) Query 73 FACSAKTGEGIEEGISWLIRQLKQQDGAPCACDADQ 108 F+C GEG I+W + L +QD ++D Sbjct 1021 FSCEQNNGEGSSSSITWKVGSLIEQDNQEETVESDH 1056 > Hs4757774 Length=182 Score = 28.9 bits (63), Expect = 2.7, Method: Compositional matrix adjust. Identities = 9/17 (52%), Positives = 16/17 (94%), Gaps = 0/17 (0%) Query 74 ACSAKTGEGIEEGISWL 90 +CSA TGEG+++G++W+ Sbjct 157 SCSALTGEGVQDGMNWV 173 > Hs18587779 Length=91 Score = 28.5 bits (62), Expect = 3.3, Method: Compositional matrix adjust. Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 0/25 (0%) Query 74 ACSAKTGEGIEEGISWLIRQLKQQD 98 A A TG G+ EG++WL Q + Q+ Sbjct 67 ATCATTGHGLYEGLNWLANQFQNQN 91 > YDL137w Length=181 Score = 28.5 bits (62), Expect = 3.4, Method: Compositional matrix adjust. Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Query 51 SARIRLSCSLCSSLSLPAFSGVFACSAKTGEGIEEGISWLIRQLKQQ 97 +A I L S + P F + + A +GEG+ EG+ WL LK Q Sbjct 136 AAEITEKLGLHSIRNRPWF--IQSTCATSGEGLYEGLEWLSNNLKNQ 180 > Hs19923609 Length=509 Score = 28.1 bits (61), Expect = 3.7, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 26/61 (42%), Gaps = 4/61 (6%) Query 18 TTSVTVASACGQGMVRLSPPPKRETLHVKYYFPSARIRLSCSLCSSLSLPAFSGVFACSA 77 T V V+ A V + P K E + + PS+R L CSLC+ F CS Sbjct 275 TKWVHVSCALWIPEVSIGSPEKMEPITKVSHIPSSRWALVCSLCNE----KFGASIQCSV 330 Query 78 K 78 K Sbjct 331 K 331 > CE11156 Length=1010 Score = 28.1 bits (61), Expect = 4.6, Method: Composition-based stats. Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 2/66 (3%) Query 38 PKRETLHVKYYFPSARIRLSCSLCSSLSLPAFSGVFAC--SAKTGEGIEEGISWLIRQLK 95 P ++L YY P L S + LS G +++ + IE I+W R L+ Sbjct 374 PISKSLDEAYYRPRVNYMLGKSRLALLSYFRLLGPMKIIDASQASKLIEMFITWAYRYLR 433 Query 96 QQDGAP 101 ++DG P Sbjct 434 KKDGPP 439 > 7300792 Length=203 Score = 27.7 bits (60), Expect = 5.0, Method: Compositional matrix adjust. Identities = 12/44 (27%), Positives = 24/44 (54%), Gaps = 4/44 (9%) Query 57 SCSLCSSLSLPAFSG----VFACSAKTGEGIEEGISWLIRQLKQ 96 + + +SL G + AC+A G G++EG+ W+ + +K+ Sbjct 160 AAEVAEKMSLVQLQGRTWEIKACTAVDGTGLKEGMDWVCKNMKK 203 > Hs4502201 Length=181 Score = 27.7 bits (60), Expect = 5.1, Method: Compositional matrix adjust. Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 0/24 (0%) Query 74 ACSAKTGEGIEEGISWLIRQLKQQ 97 A A +G+G+ EG+ WL QL+ Q Sbjct 157 ATCATSGDGLYEGLDWLSNQLRNQ 180 > Hs22049577 Length=108 Score = 27.7 bits (60), Expect = 5.1, Method: Compositional matrix adjust. Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 8/47 (17%) Query 22 TVASACGQGMVRLSPPPKRETLHVKYYFPSARIRLSCSLCSSLSLPA 68 V++ G G V L P + YF S + R CS+ SL+LPA Sbjct 57 NVSNLKGSGTVTLGP--------IVRYFGSWKARFGCSVSRSLNLPA 95 > Hs4502203 Length=181 Score = 27.7 bits (60), Expect = 5.2, Method: Compositional matrix adjust. Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 0/24 (0%) Query 74 ACSAKTGEGIEEGISWLIRQLKQQ 97 A A +G+G+ EG+ WL QLK + Sbjct 157 ATCATSGDGLYEGLDWLANQLKNK 180 > 7292144 Length=1205 Score = 27.3 bits (59), Expect = 7.2, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 0/33 (0%) Query 22 TVASACGQGMVRLSPPPKRETLHVKYYFPSARI 54 TV + CG + +SP +R+T V +Y P +I Sbjct 270 TVLAICGTTLDAVSPTSQRDTNQVCFYSPLGKI 302 > Hs22041463 Length=277 Score = 27.3 bits (59), Expect = 7.6, Method: Compositional matrix adjust. Identities = 13/46 (28%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Query 18 TTSVTVASACGQGMVRLSPPPKRETLHVKYYFPSARI---RLSCSL 60 T+S+ V++ + + ++ P P R+ V ++ P+A + L+CSL Sbjct 161 TSSLHVSTGAAKAVGKVIPKPNRKLSGVAFHVPTANVSVMDLTCSL 206 > CE27954 Length=3484 Score = 27.3 bits (59), Expect = 7.7, Method: Composition-based stats. Identities = 11/19 (57%), Positives = 13/19 (68%), Gaps = 0/19 (0%) Query 70 SGVFACSAKTGEGIEEGIS 88 SGVF C K+ EG EE +S Sbjct 3048 SGVFTCKVKSSEGDEEEVS 3066 > Hs13376488 Length=148 Score = 27.3 bits (59), Expect = 7.7, Method: Compositional matrix adjust. Identities = 13/37 (35%), Positives = 16/37 (43%), Gaps = 0/37 (0%) Query 5 KAGQAGCSIGSGNTTSVTVASACGQGMVRLSPPPKRE 41 + G G IG TT V C G+V L P P+ Sbjct 2 RRGYWGNKIGKSYTTPCMVTGCCSSGLVHLIPAPRNN 38 > Hs4507675 Length=615 Score = 26.9 bits (58), Expect = 7.9, Method: Compositional matrix adjust. Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 0/37 (0%) Query 36 PPPKRETLHVKYYFPSARIRLSCSLCSSLSLPAFSGV 72 P P E L+V Y SA L S+ + S+PAF G+ Sbjct 393 PSPMPEYLNVHYICESASRLLFLSMHRARSIPAFQGL 429 > CE00696 Length=181 Score = 26.9 bits (58), Expect = 8.0, Method: Compositional matrix adjust. Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 0/24 (0%) Query 74 ACSAKTGEGIEEGISWLIRQLKQQ 97 A A +G+G+ EG+ WL QLK + Sbjct 157 ATCATSGDGLYEGLDWLSNQLKNR 180 > Hs6912244 Length=179 Score = 26.9 bits (58), Expect = 8.3, Method: Compositional matrix adjust. Identities = 11/22 (50%), Positives = 17/22 (77%), Gaps = 0/22 (0%) Query 74 ACSAKTGEGIEEGISWLIRQLK 95 AC A TGEG+ +G+ W++ +LK Sbjct 156 ACCALTGEGLCQGLEWMMSRLK 177 > 7296589 Length=182 Score = 26.9 bits (58), Expect = 9.9, Method: Compositional matrix adjust. Identities = 11/23 (47%), Positives = 15/23 (65%), Gaps = 0/23 (0%) Query 74 ACSAKTGEGIEEGISWLIRQLKQ 96 A A +G+G+ EG+ WL QLK Sbjct 157 ATCATSGDGLYEGLDWLSNQLKN 179 Lambda K H 0.320 0.133 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1164469306 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40