bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_3055_orf1 Length=59 Score E Sequences producing significant alignments: (Bits) Value Hs4505395 42.7 2e-04 Hs18497288 40.4 8e-04 7304076 39.7 0.001 Hs20543258 39.7 0.001 Hs6679056 39.3 0.002 Hs13518037 38.9 0.003 Hs13518039 38.9 0.003 CE24549 37.4 0.007 CE01556 37.4 0.007 7291057 37.0 0.009 CE28666 37.0 0.009 Hs17440040 36.6 0.011 Hs9055270 36.6 0.011 Hs15029514 36.2 0.014 Hs6806919 36.2 0.016 Hs13124888 35.8 0.021 Hs19743803 35.0 0.031 Hs4557617 35.0 0.032 CE26701 35.0 0.034 CE28306 34.7 0.042 7301198 34.7 0.046 CE16142 34.7 0.048 CE26702 34.3 0.061 Hs4507901 34.3 0.062 Hs4503667 34.3 0.065 7304328 34.3 0.065 Hs4557591 33.9 0.076 Hs20549163 33.9 0.076 Hs4505111 33.9 0.077 Hs4503665 33.9 0.080 Hs4506117 33.5 0.090 CE25992 33.5 0.091 Hs20556510 33.1 0.12 HsM6912722 33.1 0.12 Hs21361401 33.1 0.12 Hs22044235 33.1 0.12 Hs22062035 33.1 0.13 7295215 33.1 0.14 CE18596 33.1 0.14 CE18595 33.1 0.14 Hs20536571 32.7 0.15 Hs4504975 32.7 0.16 Hs4505037 32.7 0.19 Hs8393299 32.3 0.22 7293154 32.3 0.23 CE10670 32.3 0.24 Hs5902811 32.0 0.26 CE04981 32.0 0.26 Hs6912724 32.0 0.27 Hs5902808 32.0 0.27 > Hs4505395 Length=1247 Score = 42.7 bits (99), Expect = 2e-04, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 25/34 (73%), Gaps = 2/34 (5%) Query 28 PSVCDG--VCENLPGSYKCKCLSGYKLGEDGSCI 59 PSVC +C N PG+++C+C+ GY+ ++G+C+ Sbjct 718 PSVCGSHTICNNHPGTFRCECVEGYQFSDEGTCV 751 Score = 32.3 bits (72), Expect = 0.22, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Query 28 PSVC--DGVCENLPGSYKCKCLSGYKLGEDGSCI 59 PS C D C N PGS+ C+C GY+ G+ C+ Sbjct 808 PSRCHPDAFCYNTPGSFTCQCKPGYQ-GDGFRCV 840 > Hs18497288 Length=1256 Score = 40.4 bits (93), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 18/29 (62%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Query 30 VCD-GVCENLPGSYKCKCLSGYKLGEDGS 57 VCD G+C N PGS++C+CLSGY L D S Sbjct 794 VCDNGICSNTPGSFQCQCLSGYHLSRDRS 822 Score = 36.2 bits (82), Expect = 0.017, Method: Compositional matrix adjust. Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Query 33 GVCENLPGSYKCKCLSGYKLGEDG-SCI 59 G CENLPGS++C C GY DG SC+ Sbjct 757 GWCENLPGSFRCTCAQGYAPAPDGRSCL 784 Score = 33.1 bits (74), Expect = 0.14, Method: Compositional matrix adjust. Identities = 12/20 (60%), Positives = 13/20 (65%), Gaps = 0/20 (0%) Query 33 GVCENLPGSYKCKCLSGYKL 52 G C N PG YKC C GY+L Sbjct 674 GFCINFPGHYKCNCYPGYRL 693 Score = 31.6 bits (70), Expect = 0.38, Method: Compositional matrix adjust. Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Query 27 LPSVC-DGVCENLPGSYKCKCLSGYKLG 53 +P VC G C N PGSY+C C G+ LG Sbjct 361 MPGVCRHGDCLNNPGSYRCVCPPGHSLG 388 Score = 31.2 bits (69), Expect = 0.49, Method: Compositional matrix adjust. Identities = 18/33 (54%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Query 28 PSVC-DGVCENLPGSYKC-KCLSGYKLGEDGSC 58 PS C DG CEN PGS+KC C GY+ G+C Sbjct 710 PSSCPDGKCENKPGSFKCIACQPGYRSQGGGAC 742 Score = 28.1 bits (61), Expect = 4.0, Method: Compositional matrix adjust. Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 0/20 (0%) Query 33 GVCENLPGSYKCKCLSGYKL 52 G+C N GSY C C GY+L Sbjct 630 GICMNTGGSYNCHCNRGYRL 649 Score = 27.3 bits (59), Expect = 7.0, Method: Compositional matrix adjust. Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Query 28 PSVC--DGVCENLPGSYKCKCLSGYKLGED 55 PS+C G C+NL GSY C C G+ +D Sbjct 874 PSLCLPHGACKNLQGSYVCVCDEGFTPTQD 903 > 7304076 Length=311 Score = 39.7 bits (91), Expect = 0.001, Method: Compositional matrix adjust. Identities = 15/23 (65%), Positives = 17/23 (73%), Gaps = 0/23 (0%) Query 28 PSVCDGVCENLPGSYKCKCLSGY 50 P CD VC N PGSY+C C+SGY Sbjct 107 PGTCDQVCRNTPGSYECSCVSGY 129 > Hs20543258 Length=1375 Score = 39.7 bits (91), Expect = 0.001, Method: Composition-based stats. Identities = 16/29 (55%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Query 32 DGVCENLPGSYKCKCLSGYKLGED-GSCI 59 + VC NLPGSY+C+C SGY+ +D +CI Sbjct 815 NSVCINLPGSYRCECRSGYEFADDRHTCI 843 Score = 29.6 bits (65), Expect = 1.4, Method: Composition-based stats. Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Query 33 GVCENLPGSYKCKCLSGYKLGEDGSCI 59 C N PGS+ C+C GY G+ CI Sbjct 905 ATCYNTPGSFSCRCQPGY-YGDGFQCI 930 > Hs6679056 Length=1376 Score = 39.3 bits (90), Expect = 0.002, Method: Composition-based stats. Identities = 16/29 (55%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Query 32 DGVCENLPGSYKCKCLSGYKLGED-GSCI 59 + VC NLPGSY+C+C SGY+ +D +CI Sbjct 816 NSVCINLPGSYRCECRSGYEFADDRHTCI 844 Score = 29.6 bits (65), Expect = 1.6, Method: Composition-based stats. Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Query 33 GVCENLPGSYKCKCLSGYKLGEDGSCI 59 C N PGS+ C+C GY G+ CI Sbjct 906 ATCYNTPGSFSCRCQPGY-YGDGFQCI 931 > Hs13518037 Length=956 Score = 38.9 bits (89), Expect = 0.003, Method: Composition-based stats. Identities = 15/26 (57%), Positives = 20/26 (76%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 C+ +C N+PGS+ C+C SGY L EDG Sbjct 290 CEQLCVNVPGSFVCQCYSGYALAEDG 315 Score = 34.3 bits (77), Expect = 0.063, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 C+ +C N SY C+CL G++L EDG Sbjct 577 CEHICVNSDDSYTCECLEGFRLAEDG 602 Score = 32.0 bits (71), Expect = 0.32, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 0/35 (0%) Query 21 GQLVAGLPSVCDGVCENLPGSYKCKCLSGYKLGED 55 + + L C C N+PGSY C+C GY L D Sbjct 239 AHMCSTLEHNCAHFCINIPGSYVCRCKQGYILNSD 273 Score = 30.4 bits (67), Expect = 0.75, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 C+ +C N SY CKC G+ L EDG Sbjct 618 CEHICVNNGNSYICKCSEGFVLAEDG 643 Score = 26.9 bits (58), Expect = 8.8, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 C+ C N+ SY C+C GY L +G Sbjct 413 CEHECVNMEESYYCRCHRGYTLDPNG 438 > Hs13518039 Length=937 Score = 38.9 bits (89), Expect = 0.003, Method: Composition-based stats. Identities = 15/26 (57%), Positives = 20/26 (76%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 C+ +C N+PGS+ C+C SGY L EDG Sbjct 290 CEQLCVNVPGSFVCQCYSGYALAEDG 315 Score = 33.9 bits (76), Expect = 0.068, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 C+ +C N SY C+CL G++L EDG Sbjct 577 CEHICVNSDDSYTCECLEGFRLAEDG 602 Score = 31.6 bits (70), Expect = 0.33, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 0/35 (0%) Query 21 GQLVAGLPSVCDGVCENLPGSYKCKCLSGYKLGED 55 + + L C C N+PGSY C+C GY L D Sbjct 239 AHMCSTLEHNCAHFCINIPGSYVCRCKQGYILNSD 273 Score = 30.4 bits (67), Expect = 0.81, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 C+ +C N SY CKC G+ L EDG Sbjct 618 CEHICVNNGNSYICKCSEGFVLAEDG 643 Score = 26.9 bits (58), Expect = 9.3, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 C+ C N+ SY C+C GY L +G Sbjct 413 CEHECVNMEESYYCRCHRGYTLDPNG 438 > CE24549 Length=1664 Score = 37.4 bits (85), Expect = 0.007, Method: Compositional matrix adjust. Identities = 15/26 (57%), Positives = 20/26 (76%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 C+ CEN+ G+Y+CKC GY+LG DG Sbjct 304 CEHFCENVKGTYRCKCREGYQLGRDG 329 Score = 28.5 bits (62), Expect = 3.4, Method: Compositional matrix adjust. Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 C+ +C N G Y C C G++L EDG Sbjct 429 CEQICSNQEGGYMCSCEPGFELSEDG 454 > CE01556 Length=429 Score = 37.4 bits (85), Expect = 0.007, Method: Composition-based stats. Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%) Query 35 CENLPGSYKCKCLSGYKLGEDGSCI 59 C N+PGSYKC CL GY++ + +C+ Sbjct 400 CRNVPGSYKCDCLPGYQMIGENTCL 424 > 7291057 Length=4547 Score = 37.0 bits (84), Expect = 0.009, Method: Composition-based stats. Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 0/29 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDGSCI 59 CD +C N GSY C+C GY L D CI Sbjct 240 CDQLCTNTLGSYTCQCAQGYTLINDSKCI 268 Score = 30.0 bits (66), Expect = 1.2, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 0/25 (0%) Query 28 PSVCDGVCENLPGSYKCKCLSGYKL 52 P +C C N GSY C C GY L Sbjct 1300 PGLCSQQCTNTKGSYFCSCTDGYVL 1324 Score = 28.9 bits (63), Expect = 2.1, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Query 31 CDGVCENLPGSYKCKCLSGYKL--GEDGSC 58 C C NL G+Y C C G+ L G G C Sbjct 3952 CSHQCHNLNGTYSCSCREGFHLTDGASGVC 3981 Score = 28.9 bits (63), Expect = 2.4, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 8/40 (20%) Query 28 PSVCDGV-CENL-------PGSYKCKCLSGYKLGEDGSCI 59 P+ C G C++L P Y CKC G+KL +G CI Sbjct 1601 PNPCAGSRCQHLCLLSPSAPEGYSCKCRPGFKLLSEGRCI 1640 Score = 27.7 bits (60), Expect = 5.6, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG-SCI 59 C C+ P C C G ++GEDG +CI Sbjct 1263 CSSFCQKTPNGALCVCPPGSEIGEDGYTCI 1292 Score = 27.7 bits (60), Expect = 5.6, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 11/23 (47%), Gaps = 0/23 (0%) Query 28 PSVCDGVCENLPGSYKCKCLSGY 50 P C C N PG + CKC Y Sbjct 3075 PGACSQHCSNTPGGFYCKCDETY 3097 > CE28666 Length=863 Score = 37.0 bits (84), Expect = 0.009, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 20/26 (76%), Gaps = 0/26 (0%) Query 27 LPSVCDGVCENLPGSYKCKCLSGYKL 52 + VCD +C N+PGSY+C C +GY++ Sbjct 437 IAGVCDQICLNIPGSYRCACHAGYQI 462 > Hs17440040 Length=542 Score = 36.6 bits (83), Expect = 0.011, Method: Compositional matrix adjust. Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 0/31 (0%) Query 26 GLPSVCDGVCENLPGSYKCKCLSGYKLGEDG 56 G P +C C N PGSY+C C GY+ DG Sbjct 338 GRPRLCMHACVNTPGSYRCTCPGGYRTLADG 368 > Hs9055270 Length=4599 Score = 36.6 bits (83), Expect = 0.011, Method: Composition-based stats. Identities = 16/32 (50%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Query 29 SVCDGVCENLPGSYKCKCLSGYKLGEDG-SCI 59 S C C++LP SYKCKC G++L +DG +C+ Sbjct 2936 SGCSQDCQDLPVSYKCKCWPGFQLKDDGKTCV 2967 Score = 29.6 bits (65), Expect = 1.4, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 5/37 (13%) Query 26 GLPSVCDGVCENLPGSYK---CKCLSGYKLGEDG-SC 58 G+P C +C L SYK C+C +G+ LG DG SC Sbjct 481 GMPGGCSHICL-LSSSYKTRTCRCRTGFNLGSDGRSC 516 Score = 29.3 bits (64), Expect = 1.7, Method: Composition-based stats. Identities = 11/25 (44%), Positives = 13/25 (52%), Gaps = 0/25 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGED 55 C C N GSY C C+ GY + D Sbjct 165 CSQTCRNTHGSYTCSCVEGYLMQPD 189 Score = 28.5 bits (62), Expect = 3.1, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG-SC 58 C VCE + KC C G+KL DG SC Sbjct 1224 CSQVCEQHKHTVKCSCYEGWKLDVDGESC 1252 Score = 28.1 bits (61), Expect = 4.2, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Query 25 AGLPSVCDGVCENLPGSYKCKCLSGYKLGED 55 +G P C C N G+YKC C GY++ D Sbjct 2974 SGFP--CSQQCINTYGTYKCLCTDGYEIQPD 3002 > Hs15029514 Length=2809 Score = 36.2 bits (82), Expect = 0.014, Method: Composition-based stats. Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 0/25 (0%) Query 35 CENLPGSYKCKCLSGYKLGEDGSCI 59 C N+PGSY+CKC GYKL G+C+ Sbjct 1780 CINIPGSYRCKCTRGYKLSPGGACV 1804 Score = 33.9 bits (76), Expect = 0.075, Method: Composition-based stats. Identities = 18/30 (60%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Query 28 PSVC-DGVCENLPGSYKCKCLSGYKLGEDG 56 P VC +GVCENL GSY+C C GY+ G G Sbjct 690 PEVCANGVCENLRGSYRCVCNLGYEAGASG 719 Score = 30.8 bits (68), Expect = 0.59, Method: Composition-based stats. Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 0/30 (0%) Query 28 PSVCDGVCENLPGSYKCKCLSGYKLGEDGS 57 P +C C N GSY C C +GY L EDG+ Sbjct 2174 PLLCAFRCHNTEGSYLCTCPAGYTLREDGA 2203 Score = 30.4 bits (67), Expect = 0.73, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query 28 PSVC-DGVCENLPGSYKCKCLSGYKLGEDG 56 P +C +G C N GS++C+CL G +G DG Sbjct 579 PGICVNGHCTNTEGSFRCQCLGGLAVGTDG 608 Score = 30.0 bits (66), Expect = 1.2, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 0/30 (0%) Query 27 LPSVCDGVCENLPGSYKCKCLSGYKLGEDG 56 +P C +C+N GS+ C C GY L EDG Sbjct 2412 VPKPCTFLCKNTKGSFLCSCPRGYLLEEDG 2441 Score = 29.6 bits (65), Expect = 1.3, Method: Composition-based stats. Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 0/24 (0%) Query 33 GVCENLPGSYKCKCLSGYKLGEDG 56 G CENLPG ++C C GY+L G Sbjct 1417 GSCENLPGMFRCICNGGYELDRGG 1440 Score = 29.6 bits (65), Expect = 1.4, Method: Composition-based stats. Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 32 DGVCENLPGSYKCKCLSGYKLGEDGSCI 59 +G C+N+ GSY C C G+ + +G C+ Sbjct 1858 NGTCKNIIGSYNCLCFPGFVVTHNGDCV 1885 Score = 29.6 bits (65), Expect = 1.6, Method: Composition-based stats. Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 0/25 (0%) Query 33 GVCENLPGSYKCKCLSGYKLGEDGS 57 GVC NL GSY CKC G +L G+ Sbjct 778 GVCRNLAGSYTCKCGPGSRLDPSGT 802 Score = 29.3 bits (64), Expect = 1.8, Method: Composition-based stats. Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Query 28 PSVC-DGVCENLPGSYKCKCLSGYKLG 53 P +C G C N PGS++C+C GY+ G Sbjct 1036 PDLCGQGTCVNTPGSFECECFPGYESG 1062 Score = 28.9 bits (63), Expect = 2.4, Method: Composition-based stats. Identities = 14/26 (53%), Positives = 15/26 (57%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 CD C N GSY+C C GY L DG Sbjct 1166 CDVHCINTEGSYRCSCGQGYSLMPDG 1191 Score = 27.7 bits (60), Expect = 4.8, Method: Composition-based stats. Identities = 14/26 (53%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Query 28 PSVC-DGVCENLPGSYKCKCLSGYKL 52 P VC +GVC N GS++C+C GY L Sbjct 2092 PGVCTNGVCVNTDGSFRCECPFGYSL 2117 Score = 27.7 bits (60), Expect = 5.7, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 0/29 (0%) Query 28 PSVCDGVCENLPGSYKCKCLSGYKLGEDG 56 P G C N PGS++C+C G+ L G Sbjct 2495 PCGAHGHCHNTPGSFRCECHQGFTLVSSG 2523 Score = 27.7 bits (60), Expect = 5.8, Method: Composition-based stats. Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Query 30 VCD-GVCENLPGSYKCKCLSGYKLGED 55 +CD G C+N PGSY C C G+ +D Sbjct 734 LCDNGWCQNSPGSYSCSCPPGFHFWQD 760 Score = 27.7 bits (60), Expect = 6.0, Method: Composition-based stats. Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query 28 PSVCD-GVCENLPGSYKCKCLSGYKLGED 55 P VCD G C N+PG ++C C G+ D Sbjct 1204 PRVCDQGHCTNMPGGHRCLCYDGFMATPD 1232 Score = 27.3 bits (59), Expect = 6.5, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 0/25 (0%) Query 33 GVCENLPGSYKCKCLSGYKLGEDGS 57 G C N GSYKC+C G++L G+ Sbjct 1085 GTCTNTDGSYKCQCPPGHELTAKGT 1109 Score = 27.3 bits (59), Expect = 6.9, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query 28 PSVC-DGVCENLPGSYKCKCLSGYKLGEDG 56 P++C G C N PGS++C C G+ L ++G Sbjct 1977 PNLCLFGTCTNSPGSFQCLCPPGFVLSDNG 2006 Score = 26.9 bits (58), Expect = 9.9, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 0/25 (0%) Query 32 DGVCENLPGSYKCKCLSGYKLGEDG 56 +GVC N PGSY C C ++L G Sbjct 1457 NGVCINTPGSYLCSCPQDFELNPSG 1481 > Hs6806919 Length=4655 Score = 36.2 bits (82), Expect = 0.016, Method: Composition-based stats. Identities = 16/30 (53%), Positives = 18/30 (60%), Gaps = 0/30 (0%) Query 27 LPSVCDGVCENLPGSYKCKCLSGYKLGEDG 56 +P VC CEN+ GSY CKC GY DG Sbjct 3159 MPFVCSQKCENVIGSYICKCAPGYLREPDG 3188 Score = 31.2 bits (69), Expect = 0.44, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 C C N+ GS++C C +GY L DG Sbjct 1400 CSQHCYNMRGSFRCSCDTGYMLESDG 1425 Score = 29.6 bits (65), Expect = 1.3, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 0/29 (0%) Query 30 VCDGVCENLPGSYKCKCLSGYKLGEDGSC 58 +CD CE+ PG + C C GY L C Sbjct 357 ICDQKCESRPGRHLCHCEEGYILERGQYC 385 > Hs13124888 Length=553 Score = 35.8 bits (81), Expect = 0.021, Method: Compositional matrix adjust. Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 0/32 (0%) Query 28 PSVCDGVCENLPGSYKCKCLSGYKLGEDGSCI 59 P C C N GSYKC CLSG+ L D +C+ Sbjct 102 PRPCQHRCVNTHGSYKCFCLSGHMLMPDATCV 133 > Hs19743803 Length=448 Score = 35.0 bits (79), Expect = 0.031, Method: Composition-based stats. Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 C +C N+PGSY C C G+ L EDG Sbjct 177 CQQLCANVPGSYSCTCNPGFTLNEDG 202 Score = 28.9 bits (63), Expect = 2.6, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 C C N GS+ C+C GY+L EDG Sbjct 217 CVQTCVNTYGSFICRCDPGYELEEDG 242 Score = 27.3 bits (59), Expect = 7.7, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 0/26 (0%) Query 30 VCDGVCENLPGSYKCKCLSGYKLGED 55 +C C N PG+Y C C GY L +D Sbjct 257 LCQHECVNQPGTYFCSCPPGYILLDD 282 > Hs4557617 Length=678 Score = 35.0 bits (79), Expect = 0.032, Method: Compositional matrix adjust. Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 C +C N PGS+ C C SG++L DG Sbjct 167 CLQICHNKPGSFHCSCHSGFELSSDG 192 Score = 28.5 bits (62), Expect = 3.3, Method: Compositional matrix adjust. Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Query 31 CDGVCENLPGSYKCKC--LSGYKLGED 55 C+ VC N PGSY C C G KL +D Sbjct 247 CEQVCVNSPGSYTCHCDGRGGLKLSQD 273 Score = 28.1 bits (61), Expect = 4.1, Method: Compositional matrix adjust. Identities = 10/16 (62%), Positives = 12/16 (75%), Gaps = 0/16 (0%) Query 35 CENLPGSYKCKCLSGY 50 C+NLPGSY C C G+ Sbjct 212 CKNLPGSYSCLCDEGF 227 > CE26701 Length=712 Score = 35.0 bits (79), Expect = 0.034, Method: Compositional matrix adjust. Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Query 16 RMKQKGQLVAGLPSVCDGVCENLPGSYKCKCLSGYKLGEDGS 57 R + + G+ + C+ C N+PGSY+C C G+ LG DG+ Sbjct 432 RCEDVNECTTGI-AACEQKCVNIPGSYQCICDRGFALGPDGT 472 Score = 32.3 bits (72), Expect = 0.21, Method: Compositional matrix adjust. Identities = 21/57 (36%), Positives = 26/57 (45%), Gaps = 18/57 (31%) Query 16 RMKQKGQL------VAGLPSVCDGV------------CENLPGSYKCKCLSGYKLGE 54 R +QKG L V G C+ V C NLPG+YKCKC GY+ + Sbjct 328 RCQQKGNLCAHGYEVNGATGFCEDVNECQQGVCGSMECINLPGTYKCKCGPGYEFND 384 Score = 29.3 bits (64), Expect = 1.7, Method: Compositional matrix adjust. Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 0/28 (0%) Query 29 SVCDGVCENLPGSYKCKCLSGYKLGEDG 56 +C G C N GSY C+C GYK+ DG Sbjct 489 DLCMGGCINTKGSYLCQCPPGYKIQPDG 516 Score = 28.9 bits (63), Expect = 2.4, Method: Compositional matrix adjust. Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Query 13 AAARMKQKGQLVAGLPSVCD--GVCENLPGSYKCKCLSGYKLGEDG 56 A R + + + VCD C N GS++CKC G++L DG Sbjct 385 AKKRCEDVDECIKFAGHVCDLSAECINTIGSFECKCKPGFQLASDG 430 > CE28306 Length=926 Score = 34.7 bits (78), Expect = 0.042, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 18/34 (52%), Gaps = 6/34 (17%) Query 31 CDGVCENLPGSYKCKCLSGYKLGED------GSC 58 C+ C+N GSY C C GY L ED GSC Sbjct 659 CEHTCQNRLGSYVCTCNPGYILAEDKHNCKEGSC 692 Score = 31.6 bits (70), Expect = 0.34, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query 29 SVCDGVCENLPGSYKCKCLSGYKLGEDG-SC 58 ++C C N G +KC C GY L +G SC Sbjct 508 NICHHYCVNTVGGFKCACRVGYSLSSNGFSC 538 > 7301198 Length=1057 Score = 34.7 bits (78), Expect = 0.046, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 C C N GSY+C C +GY L E+G Sbjct 754 CQHRCRNTFGSYQCSCRNGYTLAENG 779 Score = 32.0 bits (71), Expect = 0.26, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 C +C N GSY+C C +GY+L +G Sbjct 592 CQHLCINTLGSYQCGCRAGYELQANG 617 > CE16142 Length=798 Score = 34.7 bits (78), Expect = 0.048, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 20/29 (68%), Gaps = 0/29 (0%) Query 29 SVCDGVCENLPGSYKCKCLSGYKLGEDGS 57 + C+ C N+PGSY+C C G+ LG DG+ Sbjct 530 AACEQKCVNIPGSYQCICDRGFALGPDGT 558 Score = 30.4 bits (67), Expect = 0.81, Method: Composition-based stats. Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 0/27 (0%) Query 30 VCDGVCENLPGSYKCKCLSGYKLGEDG 56 +C G C N GSY C+C GYK+ DG Sbjct 576 LCMGGCINTKGSYLCQCPPGYKIQPDG 602 Score = 30.4 bits (67), Expect = 0.93, Method: Composition-based stats. Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 0/20 (0%) Query 35 CENLPGSYKCKCLSGYKLGE 54 C NLPG+YKCKC GY+ + Sbjct 451 CINLPGTYKCKCGPGYEFND 470 Score = 28.1 bits (61), Expect = 4.6, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Query 30 VCD--GVCENLPGSYKCKCLSGYKLGEDG 56 VCD C N GS++CKC G++L DG Sbjct 488 VCDLSAECINTIGSFECKCKPGFQLASDG 516 > CE26702 Length=689 Score = 34.3 bits (77), Expect = 0.061, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 20/29 (68%), Gaps = 0/29 (0%) Query 29 SVCDGVCENLPGSYKCKCLSGYKLGEDGS 57 + C+ C N+PGSY+C C G+ LG DG+ Sbjct 444 AACEQKCVNIPGSYQCICDRGFALGPDGT 472 Score = 30.0 bits (66), Expect = 0.99, Method: Composition-based stats. Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 0/27 (0%) Query 30 VCDGVCENLPGSYKCKCLSGYKLGEDG 56 +C G C N GSY C+C GYK+ DG Sbjct 490 LCMGGCINTKGSYLCQCPPGYKIQPDG 516 Score = 30.0 bits (66), Expect = 1.1, Method: Composition-based stats. Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 0/20 (0%) Query 35 CENLPGSYKCKCLSGYKLGE 54 C NLPG+YKCKC GY+ + Sbjct 365 CINLPGTYKCKCGPGYEFND 384 Score = 27.7 bits (60), Expect = 5.8, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Query 30 VCD--GVCENLPGSYKCKCLSGYKLGEDG 56 VCD C N GS++CKC G++L DG Sbjct 402 VCDLSAECINTIGSFECKCKPGFQLASDG 430 > Hs4507901 Length=873 Score = 34.3 bits (77), Expect = 0.062, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 0/25 (0%) Query 28 PSVCDGVCENLPGSYKCKCLSGYKL 52 P +C +C NL G YKC+C GY++ Sbjct 403 PGICSQICINLKGGYKCECSRGYQM 427 > Hs4503667 Length=2911 Score = 34.3 bits (77), Expect = 0.065, Method: Composition-based stats. Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%) Query 35 CENLPGSYKCKCLSGYKLGEDGSCI 59 C N PGSY+C+C +G+KL +G+C+ Sbjct 1866 CINSPGSYRCECAAGFKLSPNGACV 1890 Score = 33.9 bits (76), Expect = 0.074, Method: Composition-based stats. Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 0/29 (0%) Query 28 PSVCDGVCENLPGSYKCKCLSGYKLGEDG 56 P C+ +C+N GSY+C C GY L EDG Sbjct 2498 PKPCNYICKNTEGSYQCSCPRGYVLQEDG 2526 Score = 33.1 bits (74), Expect = 0.12, Method: Composition-based stats. Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Query 28 PSVC-DGVCENLPGSYKCKCLSGYKLGEDG 56 P +C +G+CENL GSY+C C SGY+ G Sbjct 775 PDICANGICENLRGSYRCNCNSGYEPDASG 804 Score = 30.8 bits (68), Expect = 0.69, Method: Composition-based stats. Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Query 28 PSVC-DGVCENLPGSYKCKCLSGYKLG 53 P +C G+C N PGS++C+C GY+ G Sbjct 1122 PDLCGSGICVNTPGSFECECFEGYESG 1148 Score = 30.0 bits (66), Expect = 1.1, Method: Composition-based stats. Identities = 14/26 (53%), Positives = 15/26 (57%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 CD C N GSY+C C GY L DG Sbjct 1252 CDTQCTNSEGSYECSCSEGYALMPDG 1277 Score = 29.6 bits (65), Expect = 1.5, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Query 27 LPSVCD-GVCENLPGSYKCKCLSGYKLGED 55 +P+VC G+C +L GSY+C C +G+K +D Sbjct 1898 IPNVCSHGLCVDLQGSYQCICHNGFKASQD 1927 Score = 29.6 bits (65), Expect = 1.5, Method: Composition-based stats. Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query 28 PSVCDG-VCENLPGSYKCKCLSGYKLGED 55 P +CDG C N+PG Y+C C G+ D Sbjct 1290 PDICDGGQCTNIPGEYRCLCYDGFMASMD 1318 Score = 29.3 bits (64), Expect = 1.9, Method: Composition-based stats. Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 0/24 (0%) Query 33 GVCENLPGSYKCKCLSGYKLGEDG 56 G+C+N PGS+ C+C G+ L G Sbjct 2585 GICQNTPGSFSCECQRGFSLDATG 2608 Score = 28.1 bits (61), Expect = 3.8, Method: Composition-based stats. Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Query 30 VCD-GVCENLPGSYKCKCLSGY 50 +CD G+C N PGSY C C GY Sbjct 819 LCDNGLCRNTPGSYSCTCPPGY 840 Score = 28.1 bits (61), Expect = 3.8, Method: Composition-based stats. Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 0/28 (0%) Query 32 DGVCENLPGSYKCKCLSGYKLGEDGSCI 59 +G C+N GSY C C G++L + C+ Sbjct 1944 NGTCKNTVGSYNCLCYPGFELTHNNDCL 1971 Score = 28.1 bits (61), Expect = 4.3, Method: Composition-based stats. Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query 27 LPSVCDG-VCENLPGSYKCKCLSGYKLGED 55 LP +C G C N GS++C+C GY L ED Sbjct 1656 LPGLCQGGNCINTFGSFQCECPQGYYLSED 1685 Score = 28.1 bits (61), Expect = 4.4, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query 27 LPSVCD-GVCENLPGSYKCKCLSGYKLGEDGS 57 +P +C+ G C N GSY C C GY DGS Sbjct 324 IPGICETGECSNTVGSYFCVCPRGYVTSTDGS 355 Score = 27.7 bits (60), Expect = 5.4, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Query 26 GLPSVCD-GVCENLPGSYKCKCLSGYKL 52 LP C G C+NL GS++C C GY++ Sbjct 2021 ALPGSCSPGTCQNLEGSFRCICPPGYEV 2048 Score = 27.7 bits (60), Expect = 5.5, Method: Composition-based stats. Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 0/24 (0%) Query 33 GVCENLPGSYKCKCLSGYKLGEDG 56 G C NLPG + C C GY+L G Sbjct 1503 GTCNNLPGMFHCICDDGYELDRTG 1526 Score = 27.3 bits (59), Expect = 7.8, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query 28 PSVCD-GVCENLPGSYKCKCLSGYKLGEDGS 57 P +C+ G C N+ GSY+C+C G++ G+ Sbjct 2345 PGICENGRCVNIIGSYRCECNEGFQSSSSGT 2375 Score = 26.9 bits (58), Expect = 8.5, Method: Composition-based stats. Identities = 11/20 (55%), Positives = 15/20 (75%), Gaps = 0/20 (0%) Query 32 DGVCENLPGSYKCKCLSGYK 51 +G C N PGSY CKC +G++ Sbjct 545 NGDCVNTPGSYYCKCHAGFQ 564 Score = 26.9 bits (58), Expect = 8.6, Method: Composition-based stats. Identities = 14/28 (50%), Positives = 16/28 (57%), Gaps = 0/28 (0%) Query 28 PSVCDGVCENLPGSYKCKCLSGYKLGED 55 P +C C N GSY+C C GY L ED Sbjct 2260 PLLCALRCMNTFGSYECTCPIGYALRED 2287 > 7304328 Length=447 Score = 34.3 bits (77), Expect = 0.065, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 0/29 (0%) Query 27 LPSVCDGVCENLPGSYKCKCLSGYKLGED 55 +P +C C N G Y+C C SGY+LG D Sbjct 211 IPGLCQQKCLNFWGGYRCTCNSGYQLGPD 239 Score = 33.5 bits (75), Expect = 0.090, Method: Composition-based stats. Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 0/26 (0%) Query 30 VCDGVCENLPGSYKCKCLSGYKLGED 55 +C G+C N PGSY+C C GY L D Sbjct 257 LCMGLCINTPGSYQCSCPRGYILAAD 282 > Hs4557591 Length=2871 Score = 33.9 bits (76), Expect = 0.076, Method: Composition-based stats. Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 0/29 (0%) Query 28 PSVCDGVCENLPGSYKCKCLSGYKLGEDG 56 P C+ +C+N GSY+C C GY L EDG Sbjct 2452 PKPCNFICKNTEGSYQCSCPKGYILQEDG 2480 Score = 33.5 bits (75), Expect = 0.096, Method: Composition-based stats. Identities = 16/30 (53%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Query 28 PSVC-DGVCENLPGSYKCKCLSGYKLGEDG 56 P +C +G+CENL G+YKC C SGY++ G Sbjct 731 PDICPNGICENLRGTYKCICNSGYEVDSTG 760 Score = 32.0 bits (71), Expect = 0.25, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Query 28 PSVCDG-VCENLPGSYKCKCLSGYKLGED 55 P++CDG C N+PG Y+C C G+ ED Sbjct 1246 PNICDGGQCTNIPGEYRCLCYDGFMASED 1274 Score = 31.6 bits (70), Expect = 0.40, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query 27 LPSVCD-GVCENLPGSYKCKCLSGYKLGEDG 56 LP++C G C NLPG ++C+C GY+L G Sbjct 1452 LPNICVFGTCHNLPGLFRCECEIGYELDRSG 1482 Score = 31.2 bits (69), Expect = 0.45, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 0/25 (0%) Query 33 GVCENLPGSYKCKCLSGYKLGEDGS 57 G+C+N PGS+ C+C G+ L + GS Sbjct 2539 GICQNTPGSFTCECQRGFSLDQTGS 2563 Score = 29.3 bits (64), Expect = 1.8, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query 28 PSVC-DGVCENLPGSYKCKCLSGYKLGEDG 56 P +C +G C N GSY+C+C G +G DG Sbjct 620 PGICMNGRCVNTDGSYRCECFPGLAVGLDG 649 Score = 29.3 bits (64), Expect = 1.9, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 32 DGVCENLPGSYKCKCLSGYKLGEDGSCI 59 +G C PGSY+C+C G++L G CI Sbjct 462 NGRCIPTPGSYRCECNKGFQLDLRGECI 489 Score = 29.3 bits (64), Expect = 2.0, Method: Composition-based stats. Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query 27 LPSVCDG-VCENLPGSYKCKCLSGYKLGED 55 LP +C G C N GS++C+C +GY L ED Sbjct 1613 LPGLCQGGKCINTFGSFQCRCPTGYYLNED 1642 Score = 28.9 bits (63), Expect = 2.7, Method: Composition-based stats. Identities = 15/28 (53%), Positives = 17/28 (60%), Gaps = 0/28 (0%) Query 28 PSVCDGVCENLPGSYKCKCLSGYKLGED 55 P +C C N GSY+CKC GY L ED Sbjct 2214 PLLCAFRCVNTYGSYECKCPVGYVLRED 2241 Score = 28.1 bits (61), Expect = 3.9, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query 27 LPSVCD-GVCENLPGSYKCKCLSGYKLGED 55 +PS+C G C N GS+KC+C SG+ L + Sbjct 1035 IPSLCTHGKCRNTIGSFKCRCDSGFALDSE 1064 Score = 28.1 bits (61), Expect = 4.1, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query 27 LPSVC-DGVCENLPGSYKCKCLSGYKLGEDG 56 P VC +G+C N GS+KC+C SG L G Sbjct 917 FPGVCKNGLCVNTRGSFKCQCPSGMTLDATG 947 Score = 28.1 bits (61), Expect = 4.2, Method: Composition-based stats. Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 0/20 (0%) Query 33 GVCENLPGSYKCKCLSGYKL 52 G C+NL GSY+C C GY L Sbjct 1987 GTCQNLDGSYRCICPPGYSL 2006 Score = 27.7 bits (60), Expect = 5.5, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query 26 GLPSVCDG-VCENLPGSYKCKCLSGYKLGE 54 +P +C G C N GS++CKC +G+KL E Sbjct 252 AIPGLCQGGNCINTVGSFECKCPAGHKLNE 281 Score = 27.7 bits (60), Expect = 5.9, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 0/25 (0%) Query 32 DGVCENLPGSYKCKCLSGYKLGEDG 56 +G+C N GS+KC C G++L DG Sbjct 584 NGMCINEDGSFKCICKPGFQLASDG 608 Score = 27.3 bits (59), Expect = 7.1, Method: Composition-based stats. Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 0/28 (0%) Query 32 DGVCENLPGSYKCKCLSGYKLGEDGSCI 59 +G C N GS+ C+C G+ L + CI Sbjct 1902 NGTCRNTIGSFNCRCNHGFILSHNNDCI 1929 Score = 27.3 bits (59), Expect = 7.5, Method: Composition-based stats. Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 0/24 (0%) Query 35 CENLPGSYKCKCLSGYKLGEDGSC 58 C N GSY+C C GY+ G C Sbjct 1824 CINTAGSYRCDCKPGYRFTSTGQC 1847 Score = 26.9 bits (58), Expect = 8.1, Method: Composition-based stats. Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Query 28 PSVCD-GVCENLPGSYKCKCLSGYKLG 53 P +C G C N PG ++CKC GY+ G Sbjct 1078 PDLCGRGQCVNTPGDFECKCDEGYESG 1104 Score = 26.9 bits (58), Expect = 8.2, Method: Composition-based stats. Identities = 11/20 (55%), Positives = 15/20 (75%), Gaps = 0/20 (0%) Query 33 GVCENLPGSYKCKCLSGYKL 52 GVC N GSY+C+C G++L Sbjct 1127 GVCHNTEGSYRCECPPGHQL 1146 Score = 26.9 bits (58), Expect = 8.2, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query 28 PSVCD-GVCENLPGSYKCKCLSGYKLGEDG 56 P +C G C N GS+KC C G+ L G Sbjct 2021 PEICALGTCSNTEGSFKCLCPEGFSLSSSG 2050 Score = 26.9 bits (58), Expect = 9.5, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Query 27 LPSVCD-GVCENLPGSYKCKCLSGY 50 +P VC+ GVC N+ GS++C+C G+ Sbjct 1773 IPGVCENGVCINMVGSFRCECPVGF 1797 > Hs20549163 Length=2871 Score = 33.9 bits (76), Expect = 0.076, Method: Composition-based stats. Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 0/29 (0%) Query 28 PSVCDGVCENLPGSYKCKCLSGYKLGEDG 56 P C+ +C+N GSY+C C GY L EDG Sbjct 2452 PKPCNFICKNTEGSYQCSCPKGYILQEDG 2480 Score = 33.5 bits (75), Expect = 0.096, Method: Composition-based stats. Identities = 16/30 (53%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Query 28 PSVC-DGVCENLPGSYKCKCLSGYKLGEDG 56 P +C +G+CENL G+YKC C SGY++ G Sbjct 731 PDICPNGICENLRGTYKCICNSGYEVDSTG 760 Score = 32.0 bits (71), Expect = 0.25, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Query 28 PSVCDG-VCENLPGSYKCKCLSGYKLGED 55 P++CDG C N+PG Y+C C G+ ED Sbjct 1246 PNICDGGQCTNIPGEYRCLCYDGFMASED 1274 Score = 31.6 bits (70), Expect = 0.40, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query 27 LPSVCD-GVCENLPGSYKCKCLSGYKLGEDG 56 LP++C G C NLPG ++C+C GY+L G Sbjct 1452 LPNICVFGTCHNLPGLFRCECEIGYELDRSG 1482 Score = 31.2 bits (69), Expect = 0.45, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 0/25 (0%) Query 33 GVCENLPGSYKCKCLSGYKLGEDGS 57 G+C+N PGS+ C+C G+ L + GS Sbjct 2539 GICQNTPGSFTCECQRGFSLDQTGS 2563 Score = 29.3 bits (64), Expect = 1.8, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query 28 PSVC-DGVCENLPGSYKCKCLSGYKLGEDG 56 P +C +G C N GSY+C+C G +G DG Sbjct 620 PGICMNGRCVNTDGSYRCECFPGLAVGLDG 649 Score = 29.3 bits (64), Expect = 2.0, Method: Composition-based stats. Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query 27 LPSVCDG-VCENLPGSYKCKCLSGYKLGED 55 LP +C G C N GS++C+C +GY L ED Sbjct 1613 LPGLCQGGKCINTFGSFQCRCPTGYYLNED 1642 Score = 28.9 bits (63), Expect = 2.7, Method: Composition-based stats. Identities = 15/28 (53%), Positives = 17/28 (60%), Gaps = 0/28 (0%) Query 28 PSVCDGVCENLPGSYKCKCLSGYKLGED 55 P +C C N GSY+CKC GY L ED Sbjct 2214 PLLCAFRCVNTYGSYECKCPVGYVLRED 2241 Score = 28.1 bits (61), Expect = 3.9, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query 27 LPSVCD-GVCENLPGSYKCKCLSGYKLGED 55 +PS+C G C N GS+KC+C SG+ L + Sbjct 1035 IPSLCTHGKCRNTIGSFKCRCDSGFALDSE 1064 Score = 28.1 bits (61), Expect = 4.1, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query 27 LPSVC-DGVCENLPGSYKCKCLSGYKLGEDG 56 P VC +G+C N GS+KC+C SG L G Sbjct 917 FPGVCKNGLCVNTRGSFKCQCPSGMTLDATG 947 Score = 28.1 bits (61), Expect = 4.2, Method: Composition-based stats. Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 0/20 (0%) Query 33 GVCENLPGSYKCKCLSGYKL 52 G C+NL GSY+C C GY L Sbjct 1987 GTCQNLDGSYRCICPPGYSL 2006 Score = 27.7 bits (60), Expect = 5.5, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query 26 GLPSVCDG-VCENLPGSYKCKCLSGYKLGE 54 +P +C G C N GS++CKC +G+KL E Sbjct 252 AIPGLCQGGNCINTVGSFECKCPAGHKLNE 281 Score = 27.7 bits (60), Expect = 5.9, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 0/25 (0%) Query 32 DGVCENLPGSYKCKCLSGYKLGEDG 56 +G+C N GS+KC C G++L DG Sbjct 584 NGMCINEDGSFKCICKPGFQLASDG 608 Score = 27.3 bits (59), Expect = 7.1, Method: Composition-based stats. Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 0/28 (0%) Query 32 DGVCENLPGSYKCKCLSGYKLGEDGSCI 59 +G C N GS+ C+C G+ L + CI Sbjct 1902 NGTCRNTIGSFNCRCNHGFILSHNNDCI 1929 Score = 27.3 bits (59), Expect = 7.5, Method: Composition-based stats. Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 0/24 (0%) Query 35 CENLPGSYKCKCLSGYKLGEDGSC 58 C N GSY+C C GY+ G C Sbjct 1824 CINTAGSYRCDCKPGYRFTSTGQC 1847 Score = 26.9 bits (58), Expect = 8.1, Method: Composition-based stats. Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Query 28 PSVCD-GVCENLPGSYKCKCLSGYKLG 53 P +C G C N PG ++CKC GY+ G Sbjct 1078 PDLCGRGQCVNTPGDFECKCDEGYESG 1104 Score = 26.9 bits (58), Expect = 8.2, Method: Composition-based stats. Identities = 11/20 (55%), Positives = 15/20 (75%), Gaps = 0/20 (0%) Query 33 GVCENLPGSYKCKCLSGYKL 52 GVC N GSY+C+C G++L Sbjct 1127 GVCHNTEGSYRCECPPGHQL 1146 Score = 26.9 bits (58), Expect = 8.2, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query 28 PSVCD-GVCENLPGSYKCKCLSGYKLGEDG 56 P +C G C N GS+KC C G+ L G Sbjct 2021 PEICALGTCSNTEGSFKCLCPEGFSLSSSG 2050 Score = 26.9 bits (58), Expect = 9.5, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Query 27 LPSVCD-GVCENLPGSYKCKCLSGY 50 +P VC+ GVC N+ GS++C+C G+ Sbjct 1773 IPGVCENGVCINMVGSFRCECPVGF 1797 > Hs4505111 Length=496 Score = 33.9 bits (76), Expect = 0.077, Method: Compositional matrix adjust. Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 C+ VC + PGSY C C G+ L DG Sbjct 234 CEQVCISSPGSYTCACHEGFTLNSDG 259 > Hs4503665 Length=1184 Score = 33.9 bits (76), Expect = 0.080, Method: Compositional matrix adjust. Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 0/27 (0%) Query 30 VCDGVCENLPGSYKCKCLSGYKLGEDG 56 +C CEN GSY+C C SG+ L DG Sbjct 912 LCQHTCENTLGSYRCSCASGFLLAADG 938 Score = 32.0 bits (71), Expect = 0.27, Method: Compositional matrix adjust. Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 C C N+ GSY+C C GY+L EDG Sbjct 952 CSQECANIYGSYQCYCRQGYQLAEDG 977 Score = 31.6 bits (70), Expect = 0.36, Method: Compositional matrix adjust. Identities = 11/18 (61%), Positives = 15/18 (83%), Gaps = 0/18 (0%) Query 34 VCENLPGSYKCKCLSGYK 51 VC NLPGSY+C C +G++ Sbjct 874 VCHNLPGSYRCDCKAGFQ 891 Score = 30.4 bits (67), Expect = 0.77, Method: Compositional matrix adjust. Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%) Query 30 VCDGVCENLPGSYKCKCLSGYKLGEDG 56 +C +C N GSY C C G+ L +DG Sbjct 615 LCQHLCINTVGSYHCACFPGFSLQDDG 641 > Hs4506117 Length=676 Score = 33.5 bits (75), Expect = 0.090, Method: Compositional matrix adjust. Identities = 12/25 (48%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Query 28 PSVC-DGVCENLPGSYKCKCLSGYK 51 PS+C VC+N+PG ++C+C GY+ Sbjct 209 PSICGTAVCKNIPGDFECECPEGYR 233 Score = 30.8 bits (68), Expect = 0.59, Method: Compositional matrix adjust. Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 0/22 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKL 52 C +C+N PGSY C C +G+ + Sbjct 171 CSQICDNTPGSYHCSCKNGFVM 192 > CE25992 Length=922 Score = 33.5 bits (75), Expect = 0.091, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 CD C N P +C C GYKL +DG Sbjct 306 CDHTCMNTPHGARCICQEGYKLADDG 331 Score = 33.5 bits (75), Expect = 0.097, Method: Composition-based stats. Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query 30 VCDGVCENLPGSYKCKCLSGYKLGEDG-SC 58 +C CE+ GS+ CKC +GY+L DG SC Sbjct 346 LCQHFCEDRLGSFACKCANGYELETDGHSC 375 > Hs20556510 Length=1007 Score = 33.1 bits (74), Expect = 0.12, Method: Compositional matrix adjust. Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 0/22 (0%) Query 35 CENLPGSYKCKCLSGYKLGEDG 56 C N+PG+Y+C C G+ L DG Sbjct 86 CVNIPGNYRCTCYDGFHLAHDG 107 Score = 31.6 bits (70), Expect = 0.41, Method: Compositional matrix adjust. Identities = 12/22 (54%), Positives = 15/22 (68%), Gaps = 0/22 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKL 52 CD +C N GS++C C GYKL Sbjct 295 CDHICRNTVGSFECSCKKGYKL 316 Score = 31.2 bits (69), Expect = 0.48, Method: Compositional matrix adjust. Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 0/23 (0%) Query 30 VCDGVCENLPGSYKCKCLSGYKL 52 CD +C N PGS++C C GY L Sbjct 334 TCDHICVNTPGSFQCLCHRGYLL 356 Score = 30.8 bits (68), Expect = 0.61, Method: Compositional matrix adjust. Identities = 12/19 (63%), Positives = 14/19 (73%), Gaps = 0/19 (0%) Query 32 DGVCENLPGSYKCKCLSGY 50 D +C+N P SYKC C SGY Sbjct 43 DAICQNTPRSYKCICKSGY 61 > HsM6912722 Length=1013 Score = 33.1 bits (74), Expect = 0.12, Method: Composition-based stats. Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 0/25 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGED 55 C+ C N GSY+C C GY+LG D Sbjct 586 CEQRCLNTLGSYQCACEPGYELGPD 610 > Hs21361401 Length=1013 Score = 33.1 bits (74), Expect = 0.12, Method: Composition-based stats. Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 0/25 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGED 55 C+ C N GSY+C C GY+LG D Sbjct 586 CEQRCLNTLGSYQCACEPGYELGPD 610 > Hs22044235 Length=1229 Score = 33.1 bits (74), Expect = 0.12, Method: Compositional matrix adjust. Identities = 13/23 (56%), Positives = 16/23 (69%), Gaps = 0/23 (0%) Query 34 VCENLPGSYKCKCLSGYKLGEDG 56 VC N PG Y+C C +GY+L DG Sbjct 280 VCTNNPGGYECGCYAGYRLSADG 302 Score = 31.2 bits (69), Expect = 0.46, Method: Compositional matrix adjust. Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 0/25 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGED 55 C+ C NL GS++C C +GY+L ED Sbjct 318 CEHHCTNLAGSFQCSCEAGYRLHED 342 Score = 30.0 bits (66), Expect = 1.2, Method: Compositional matrix adjust. Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Query 22 QLVAGLPSVCDGVCENLPGSYKCKCLSGYKLGEDG 56 + AGL + C C N GS+KC C +GY+LG DG Sbjct 183 ECAAGL-AQCAHGCLNTQGSFKCVCHAGYELGADG 216 Score = 27.7 bits (60), Expect = 5.2, Method: Compositional matrix adjust. Identities = 11/21 (52%), Positives = 14/21 (66%), Gaps = 0/21 (0%) Query 35 CENLPGSYKCKCLSGYKLGED 55 C N PGSY C+C G++L D Sbjct 71 CVNTPGSYLCECKPGFRLHTD 91 > Hs22062035 Length=179 Score = 33.1 bits (74), Expect = 0.13, Method: Compositional matrix adjust. Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 0/22 (0%) Query 35 CENLPGSYKCKCLSGYKLGEDG 56 C N+PG+Y+C C G+ L DG Sbjct 65 CLNIPGNYRCTCFDGFMLAHDG 86 Score = 30.0 bits (66), Expect = 1.1, Method: Compositional matrix adjust. Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 0/20 (0%) Query 32 DGVCENLPGSYKCKCLSGYK 51 D +C+N P SYKC C GY+ Sbjct 22 DALCQNTPTSYKCSCKPGYQ 41 > 7295215 Length=1394 Score = 33.1 bits (74), Expect = 0.14, Method: Compositional matrix adjust. Identities = 14/22 (63%), Positives = 16/22 (72%), Gaps = 0/22 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKL 52 C VC NLPGSY C C +GY+L Sbjct 504 CQQVCRNLPGSYGCICAAGYEL 525 Score = 32.7 bits (73), Expect = 0.17, Method: Compositional matrix adjust. Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 0/27 (0%) Query 29 SVCDGVCENLPGSYKCKCLSGYKLGED 55 +VC CEN GS++C C+ GY L ED Sbjct 289 AVCQQKCENTIGSFRCTCVEGYHLLED 315 Score = 32.0 bits (71), Expect = 0.32, Method: Compositional matrix adjust. Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 0/30 (0%) Query 30 VCDGVCENLPGSYKCKCLSGYKLGEDGSCI 59 +C C+N PG Y+C+C G L E+ +C+ Sbjct 423 LCSHTCQNTPGGYQCQCPEGLNLVEEYTCL 452 Score = 32.0 bits (71), Expect = 0.32, Method: Compositional matrix adjust. Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 34 VCENLPGSYKCKCLSGYKLGEDGSCI 59 +CENL GSY C C GY LG D + Sbjct 553 LCENLNGSYTCLCPPGYALGLDNHIV 578 Score = 31.2 bits (69), Expect = 0.50, Method: Compositional matrix adjust. Identities = 13/18 (72%), Positives = 14/18 (77%), Gaps = 0/18 (0%) Query 27 LPSVCDGVCENLPGSYKC 44 L S C G CENLPGSY+C Sbjct 203 LSSNCQGACENLPGSYRC 220 Score = 30.4 bits (67), Expect = 0.81, Method: Compositional matrix adjust. Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 0/25 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGED 55 C C+N PG ++C C GY L ED Sbjct 613 CSHFCQNEPGGFQCACPLGYALSED 637 Score = 30.0 bits (66), Expect = 1.1, Method: Compositional matrix adjust. Identities = 14/26 (53%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Query 31 CDGVCENLP-GSYKCKCLSGYKLGED 55 C C++LP GSY+C C GY+L ED Sbjct 337 CAHECQDLPEGSYRCVCPKGYELSED 362 Score = 29.3 bits (64), Expect = 1.6, Method: Compositional matrix adjust. Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 0/25 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGED 55 C C N GS+KC C GY+L D Sbjct 813 CSHRCSNTEGSFKCSCPPGYELDSD 837 Score = 28.5 bits (62), Expect = 3.2, Method: Compositional matrix adjust. Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 C +C N PG + C C +G++L DG Sbjct 654 CSQLCLNQPGGFACACETGFELTPDG 679 Score = 28.1 bits (61), Expect = 4.7, Method: Compositional matrix adjust. Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 0/25 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGED 55 C +C NL G++ C C GY+L +D Sbjct 695 CSDICINLLGTHACACERGYELAKD 719 > CE18596 Length=5198 Score = 33.1 bits (74), Expect = 0.14, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 CD C N G ++C C GY+L E+G Sbjct 5006 CDFECINYDGGFQCNCPLGYELAEEG 5031 > CE18595 Length=5175 Score = 33.1 bits (74), Expect = 0.14, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 CD C N G ++C C GY+L E+G Sbjct 4983 CDFECINYDGGFQCNCPLGYELAEEG 5008 > Hs20536571 Length=5635 Score = 32.7 bits (73), Expect = 0.15, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query 27 LPSVCDGVCENLPGSYKCKCLSG-YKLGEDGSC 58 +P C C N PGS+KC C G + LG+ SC Sbjct 5322 VPKPCAHQCSNTPGSFKCICPPGQHLLGDGKSC 5354 Score = 30.8 bits (68), Expect = 0.69, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 C C+N GSY+C C GY+L +G Sbjct 5442 CQHECKNTFGSYQCICPPGYQLTHNG 5467 Score = 29.6 bits (65), Expect = 1.4, Method: Composition-based stats. Identities = 10/18 (55%), Positives = 13/18 (72%), Gaps = 0/18 (0%) Query 34 VCENLPGSYKCKCLSGYK 51 +CEN GSY+C C GY+ Sbjct 5288 ICENTRGSYRCVCPRGYR 5305 Score = 28.1 bits (61), Expect = 4.4, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Query 22 QLVAGLPSVCDGVCENLPGSYKCKCLSGYKLGEDG 56 + AG P C C N G+Y C C G + DG Sbjct 5110 ECAAGNP--CSHSCHNAMGTYYCSCPKGLTIAADG 5142 Score = 27.7 bits (60), Expect = 5.8, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 4/35 (11%) Query 29 SVC--DGVCENLPGSYKC--KCLSGYKLGEDGSCI 59 +VC D C+N G YKC C +G E+G+CI Sbjct 5237 NVCRPDQHCKNTRGGYKCIDLCPNGMTKAENGTCI 5271 Score = 27.3 bits (59), Expect = 7.1, Method: Composition-based stats. Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 3/27 (11%) Query 35 CENLPGSYKC--KCLSGYKLGEDG-SC 58 C+N GSY+C +C SG++ DG SC Sbjct 5164 CDNTIGSYRCVVRCGSGFRRTSDGLSC 5190 > Hs4504975 Length=860 Score = 32.7 bits (73), Expect = 0.16, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 0/25 (0%) Query 28 PSVCDGVCENLPGSYKCKCLSGYKL 52 P C +C NL G YKC+C G++L Sbjct 361 PDTCSQLCVNLEGGYKCQCEEGFQL 385 > Hs4505037 Length=1587 Score = 32.7 bits (73), Expect = 0.19, Method: Compositional matrix adjust. Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query 27 LPSVCD-GVCENLPGSYKCKCLSGYKLGEDGS 57 +P CD G CEN PGS+ C C +GY+ G+ Sbjct 599 VPPPCDLGRCENTPGSFLCVCPAGYQAAPHGA 630 Score = 31.6 bits (70), Expect = 0.36, Method: Compositional matrix adjust. Identities = 13/23 (56%), Positives = 17/23 (73%), Gaps = 0/23 (0%) Query 34 VCENLPGSYKCKCLSGYKLGEDG 56 VC+NLPGS++C C GY+ DG Sbjct 1027 VCQNLPGSFQCLCDQGYEGARDG 1049 Score = 31.6 bits (70), Expect = 0.38, Method: Compositional matrix adjust. Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Query 35 CENLPGSYKC--KCLSGYKLGEDGSC 58 CEN PGSY+C C GY G +G+C Sbjct 941 CENSPGSYRCVRDCDPGYHAGPEGTC 966 Score = 30.4 bits (67), Expect = 0.84, Method: Compositional matrix adjust. Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 28 PSVCDGVCENLPGSYKCKCLSGYKLG 53 P G CEN PGS++C C G++ G Sbjct 559 PPCAPGRCENSPGSFRCVCGPGFRAG 584 Score = 29.3 bits (64), Expect = 1.7, Method: Compositional matrix adjust. Identities = 10/19 (52%), Positives = 16/19 (84%), Gaps = 0/19 (0%) Query 33 GVCENLPGSYKCKCLSGYK 51 G C+NLPGS++C C +G++ Sbjct 648 GGCKNLPGSFRCVCPAGFR 666 Score = 28.5 bits (62), Expect = 3.5, Method: Compositional matrix adjust. Identities = 10/23 (43%), Positives = 15/23 (65%), Gaps = 0/23 (0%) Query 33 GVCENLPGSYKCKCLSGYKLGED 55 G+C N GS++C C G++ G D Sbjct 896 GICTNTDGSFECICPPGHRAGPD 918 Score = 27.3 bits (59), Expect = 7.1, Method: Compositional matrix adjust. Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Query 35 CENLPGSYKCK--CLSGYKLGEDGSC 58 CEN PGSY+C C GY+ G C Sbjct 985 CENTPGSYRCTPACDPGYQPTPGGGC 1010 > Hs8393299 Length=443 Score = 32.3 bits (72), Expect = 0.22, Method: Compositional matrix adjust. Identities = 14/30 (46%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG-SCI 59 C C NLPGS++C+C G++LG + SC+ Sbjct 173 CQHRCVNLPGSFRCQCEPGFQLGPNNRSCV 202 Score = 30.8 bits (68), Expect = 0.62, Method: Compositional matrix adjust. Identities = 11/17 (64%), Positives = 13/17 (76%), Gaps = 0/17 (0%) Query 35 CENLPGSYKCKCLSGYK 51 C NLPGSY+C C GY+ Sbjct 140 CHNLPGSYQCTCPDGYR 156 > 7293154 Length=2009 Score = 32.3 bits (72), Expect = 0.23, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 0/26 (0%) Query 30 VCDGVCENLPGSYKCKCLSGYKLGED 55 VC C N GS+KC C +GY L D Sbjct 575 VCSQKCHNTMGSFKCSCETGYILRPD 600 > CE10670 Length=1827 Score = 32.3 bits (72), Expect = 0.24, Method: Composition-based stats. Identities = 12/17 (70%), Positives = 14/17 (82%), Gaps = 0/17 (0%) Query 35 CENLPGSYKCKCLSGYK 51 C NLPGSY C+CL GY+ Sbjct 480 CVNLPGSYMCQCLDGYQ 496 Score = 31.2 bits (69), Expect = 0.53, Method: Composition-based stats. Identities = 12/22 (54%), Positives = 15/22 (68%), Gaps = 0/22 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKL 52 CD +C N GSYKC C +GY + Sbjct 637 CDHLCINTQGSYKCDCRNGYDI 658 > Hs5902811 Length=717 Score = 32.0 bits (71), Expect = 0.26, Method: Composition-based stats. Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 0/25 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGED 55 C+ C N GSYKC C GY+L D Sbjct 559 CEQRCLNTLGSYKCSCDPGYELAPD 583 > CE04981 Length=757 Score = 32.0 bits (71), Expect = 0.26, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Query 30 VCDGVCENL-PGSYKCKCLSGYKLGEDG-SC 58 +C+ +CE L P +Y+C C G+ L +DG SC Sbjct 63 LCEQLCEALSPETYECSCWEGHVLQDDGLSC 93 > Hs6912724 Length=1015 Score = 32.0 bits (71), Expect = 0.27, Method: Composition-based stats. Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 0/25 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGED 55 C+ C N GSYKC C GY+L D Sbjct 588 CEHRCVNTLGSYKCACDPGYELAAD 612 Score = 30.8 bits (68), Expect = 0.60, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGEDG 56 C C N GSY C+C +GY L E+G Sbjct 743 CQHECVNTFGSYLCRCRNGYWLHENG 768 > Hs5902808 Length=823 Score = 32.0 bits (71), Expect = 0.27, Method: Composition-based stats. Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 0/25 (0%) Query 31 CDGVCENLPGSYKCKCLSGYKLGED 55 C+ C N GSYKC C GY+L D Sbjct 559 CEQRCLNTLGSYKCSCDPGYELAPD 583 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1184950242 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40